SecReT4
Protein ID: 218711146
T4SS name [ID]Tra_I [168]
Gene symboltraJ
Locus tagpECED1a_0122
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]93630..94841 [-]
Productputative Plasmid transfer ATPase
Component typeTraJ_I
UniProt IDB7LIS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.2e-33, Aligned region: 164..313
AAA_25 [PF13481], Evalue: 7.3e-05, Aligned region: 167..217
Protein Sequence: 403 a.a.     [Download]
>gi|218711146|ref|YP_002418766.1| putative Plasmid transfer ATPase [Escherichia coli ED1a]
MLNLRCRNRAGALLSAPKERKMISPDDFGTFPFSRFTAEEFRHFFAWCARHRVSDIDLTGGSPVSVSRFG
RRVRSSVNPLPSSIMMALSDELFGREVLPRVLSGHPVDRTIQVSGDASGRYGLQRGQRVRLRCHLIQGTS
ATEEKAISVTMRVIPSDIPDILTMNIEPDLLDAMLRKTGLGFICGETGSGKSTLAAALYRHILKNFPDRK
IVTYEDPVEYILGGENDLLPPHQAEIGRDVESFAAGLRSAVRRNPDIIGIGEIRDYETADAAVQAGNTGH
FCIGTMHTKSPGETFARLLGLFPPEIRDSMAAATLSLVQFILVQVLVRTNDGGRQAVREYIVITDELRDT
LSRQSHATWGHYIDEIIRKEKRRIRDQVLTMYQTGSIEASEAALFIPAGEFPK
 
Nucleotide Sequence: 1212 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c94841-93630 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGCTGAATTTACGCTGCAGAAATCGCGCTGGCGCCCTCTTGTCAGCACCGAAGGAGAGAAAAATGATAT
CACCAGATGACTTCGGTACCTTCCCCTTCTCCCGTTTTACGGCAGAAGAGTTTCGCCATTTTTTTGCCTG
GTGTGCCCGCCACCGCGTCAGTGATATTGATCTGACCGGCGGTTCACCGGTATCCGTCAGTCGCTTTGGA
CGGCGGGTTCGCTCATCCGTAAATCCCCTTCCGTCCTCCATCATGATGGCACTGAGTGATGAGCTGTTTG
GGCGGGAGGTTCTTCCCCGGGTTCTGTCAGGTCATCCCGTGGATCGTACCATTCAGGTCAGCGGAGATGC
CTCCGGCCGCTATGGCCTGCAACGAGGTCAGCGTGTTCGCCTGCGCTGCCACCTGATACAGGGAACATCG
GCAACAGAAGAAAAAGCCATTTCCGTCACCATGCGGGTGATCCCGTCAGATATTCCGGACATCCTCACTA
TGAATATTGAACCGGATCTGCTGGATGCCATGCTCAGAAAAACCGGCCTGGGCTTCATCTGCGGAGAAAC
CGGCTCCGGGAAATCCACACTGGCGGCGGCACTGTATCGCCACATTCTGAAAAATTTCCCCGATCGCAAA
ATAGTGACCTATGAAGATCCGGTGGAATACATTCTGGGCGGAGAGAATGACCTTCTGCCTCCCCATCAGG
CCGAAATCGGGCGCGATGTGGAAAGTTTTGCGGCAGGACTTCGCTCTGCCGTTCGCCGTAACCCGGACAT
CATCGGTATCGGTGAAATCAGGGATTATGAAACGGCAGATGCAGCCGTCCAGGCAGGTAACACCGGTCAC
TTCTGCATCGGCACCATGCACACCAAATCACCCGGTGAAACCTTTGCCCGGCTGCTGGGGTTATTTCCAC
CGGAAATCAGGGATTCAATGGCAGCCGCCACCCTTTCCCTGGTGCAGTTCATTCTGGTGCAGGTCCTGGT
CAGAACAAATGACGGTGGCAGACAGGCCGTCCGGGAATACATCGTCATAACTGACGAACTGCGTGATACG
CTCTCCCGGCAGTCCCATGCGACATGGGGGCATTACATTGATGAAATCATTCGCAAGGAAAAACGGCGGA
TACGGGATCAGGTTCTGACCATGTATCAGACGGGCAGCATTGAGGCATCAGAAGCTGCGCTCTTCATCCC
GGCCGGAGAATTCCCCAAATGA
 Primer design