SecReT4
Protein ID: 218711147
T4SS name [ID]Tra_I [168]
Gene symboltraI
Locus tagpECED1a_0123
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]94762..95598 [-]
Productconserved hypothetical protein, putative Lipoprotein
Component typeTraI_I
UniProt IDB7LIS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 278 a.a.     [Download]
>gi|218711147|ref|YP_002418767.1| conserved hypothetical protein, putative Lipoprotein [Escherichia coli ED1a]
MKKQVCLLLSGLLLAGCAGQHHRPPAGMAGNLPPPDLRAWLTPTDNQDDGISDTRRQMLTDAGRTLGFRG
GKAQRSWELIQALNARESTLNALYDFRPLISREGWLPPVIDEAQDVAHIQPDQIRTASRVWTILRPERFV
SNPPGWRDWLLRGLSTTATPGTEGRVVPEDRAQRRLWENALRQGWQEGRDNADLTLEANQKRLTRDYRGM
MLYALLWRQGMITRPDVTEQRQTVTGNGRKLITGDRVRRLKTHAEFTLQKSRWRPLVSTEGEKNDITR
 
Nucleotide Sequence: 837 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c95598-94762 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGAAAAAACAGGTCTGTCTCCTGCTGTCCGGGCTCCTGCTGGCAGGCTGTGCCGGACAGCACCATCGCC
CCCCTGCCGGTATGGCAGGCAATTTACCACCGCCGGATCTCCGGGCATGGCTGACGCCCACTGACAACCA
GGATGACGGCATTTCAGACACCCGTCGCCAGATGCTCACGGACGCCGGACGAACGCTGGGATTCCGTGGC
GGAAAAGCACAGCGCTCATGGGAACTGATTCAGGCACTGAATGCCCGGGAAAGTACACTGAATGCCCTGT
ATGACTTCCGTCCCCTTATCAGCAGGGAAGGCTGGCTACCCCCTGTTATTGATGAAGCGCAGGATGTTGC
TCACATTCAGCCTGACCAGATAAGAACCGCGTCCCGTGTCTGGACCATCCTGCGTCCCGAACGTTTTGTC
AGTAACCCGCCGGGCTGGCGTGACTGGCTTCTGCGGGGGCTTTCCACTACCGCCACCCCGGGAACTGAGG
GCCGTGTTGTACCGGAAGACCGCGCACAGCGCAGACTCTGGGAAAACGCACTCCGCCAGGGCTGGCAAGA
AGGCCGTGACAACGCTGACCTCACCCTGGAAGCCAACCAGAAACGCCTGACCCGGGATTACCGGGGAATG
ATGCTTTATGCCCTGCTCTGGCGTCAGGGCATGATCACACGCCCGGATGTGACTGAACAGCGGCAGACCG
TCACCGGTAACGGCAGGAAACTCATCACTGGCGATCGCGTCCGCCGCCTGAAAACACATGCTGAATTTAC
GCTGCAGAAATCGCGCTGGCGCCCTCTTGTCAGCACCGAAGGAGAGAAAAATGATATCACCAGATGA
 Primer design