SecReT4
Protein ID: 218711148
T4SS name [ID]Tra_I [168]
Gene symboltraH
Locus tagpECED1a_0124
StrainEscherichia coli ED1a plasmid pECOED (NC_011754)
Repliconplasmid pECOED [GenBank: NC_011754] [Browse all T4SS(s) in this replicon]
Location [Strand]95595..96053 [-]
Productconserved hypothetical protein, putative Lipoprotein
Component typeTraH_I
UniProt IDB7LIS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 152 a.a.     [Download]
>gi|218711148|ref|YP_002418768.1| conserved hypothetical protein, putative Lipoprotein [Escherichia coli ED1a]
MQKKRITLAGGVAMLCLSGCHLPPDNTAPARKYGAASEVAVTRHAQYQLWEQDTYSAALPSRQPGGSLQA
HSGRVSFDWEGDALELLSELARLRGQQFSYSGVRLPLPVSLHVRDMTFADALRLTEAQTAWRAVLSQSAG
RLHLSYMPTEKK
 
Nucleotide Sequence: 459 bp     [Download]
>gi|218711035|ref|NC_011754.1|:c96053-95595 Escherichia coli ED1a plasmid pECOED, complete sequence
ATGCAAAAAAAACGTATCACCCTTGCAGGGGGAGTTGCCATGCTCTGTCTGAGCGGCTGTCATCTTCCCC
CGGATAATACCGCACCGGCCAGGAAGTACGGTGCAGCTTCTGAAGTCGCTGTCACACGACATGCACAGTA
TCAGTTGTGGGAGCAGGACACGTATTCTGCAGCCCTGCCTTCCCGCCAGCCCGGAGGCAGCCTGCAGGCT
CACAGCGGGCGGGTTTCCTTTGACTGGGAAGGCGATGCTCTGGAGCTCCTGAGCGAGCTGGCCCGTCTGC
GCGGACAACAGTTCAGTTACAGCGGCGTGCGTCTTCCCCTGCCCGTCTCACTCCATGTACGCGATATGAC
CTTCGCTGATGCCCTTCGTCTCACAGAGGCCCAGACTGCCTGGCGGGCAGTCCTCTCACAGTCAGCCGGG
CGTTTACATCTTTCCTATATGCCAACGGAGAAAAAATGA
 Primer design