SecReT4
Protein ID: 218891372
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26461
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2842975..2844495 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDB7V518
KEGG IDpag:PLES_26461
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.6e-126, Aligned region: 10..490
Protein Sequence: 506 a.a.     [Download]
>gi|218891372|ref|YP_002440239.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLSTIQYDSSRSAQCQVSVPQPTETGWSQSFSTINNQSAKVPVWWAFMHALS
RAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFSRDCYGPARAKLFMQRPDLDEQQMHDVTW
IGSRFFTDTGGYYDSYRSSTAREAWPYDDTRDAGLAQVANGGGYPTCRQWWSDGSNGLRARLLGQVDPTL
LNRLAGWAGFLSRAEVDDSVIRAIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRATGDVGMAVGAIAAF
PAMDVVRQSLPMILALLKMALVICIPLVLVVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVMGTMFLVLPGFWLASLTWVGIRAGHVIQGLSDGSKSAG
QAGGKGAGALTGGKLK
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2844495-2842975 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACGCTCTTCACGACCGACTATCTGGAGTACTACCTCACCCTCGTGTCCTGGATCGTCAACAACGGTA
TCTGGGCCGTGCTGGTGTCCAGCGGGGTGTTCGCGCTGCCTTTCGTCGCCATCGTCGTGCAGGAGTGGCT
GAAGGCCCGCGCGGAAGGCGCTGACGAGGGCAACAAAGGCGTTCTGAGTGCCGCCCGTATCGAGAACCGG
GTGTTCGTCGCGATCGTGGTGGTGATGTTCGCGGGCATTCCGTTCATCGACGTGGACCTCAGCACCATCC
AGTACGACAGCTCGCGCTCGGCGCAGTGCCAGGTCAGCGTGCCGCAGCCCACGGAAACCGGCTGGTCGCA
GTCCTTCAGCACCATCAACAACCAGTCGGCGAAGGTGCCGGTCTGGTGGGCTTTCATGCACGCGCTCTCG
CGCGCCGTCACGAGCGCCTCGGTAGCGGCGATCCCGTGCGGTACGGACCTGCGGCAGATGAGGATGGAGA
TCGACGCGACCCGCATTGACGACCCGGTACTGGCTCAGGAGGTCGCGGACTTCTCGCGGGATTGCTATGG
GCCTGCGCGGGCCAAATTGTTCATGCAGCGCCCGGATCTCGATGAGCAGCAGATGCACGACGTAACCTGG
ATCGGCTCGCGCTTTTTCACGGACACGGGTGGCTACTACGACAGCTACCGCTCCAGCACGGCGCGCGAGG
CATGGCCCTATGACGACACCCGCGATGCAGGCCTCGCGCAGGTTGCCAATGGTGGCGGCTACCCGACCTG
CAGGCAGTGGTGGTCAGACGGCAGCAACGGCCTGCGCGCGCGGCTGCTGGGGCAAGTGGACCCGACCCTG
CTGAATCGCCTGGCGGGCTGGGCCGGGTTCCTCAGCCGGGCCGAGGTGGACGATTCGGTGATCCGCGCCA
TCGCGTCACCGCGGCAGCAGAAACTGAACCAGGGCAGCGTCTATACGGACTACGGCGGCCAGATCGACAA
GACCCTGCCGAACATCGTGACGCGCGCCACGGGCGACGTGGGGATGGCAGTCGGCGCGATTGCCGCGTTT
CCTGCCATGGATGTCGTGCGCCAATCCCTGCCCATGATCCTCGCCTTACTGAAGATGGCGCTGGTCATCT
GCATCCCGCTCGTGCTGGTTGTGGGCACCTACGACCTGAAGACGGTCGTCACCGTCAGCGTCGTGCAGTT
CGCGCTGTTCTTCACGGACTTCTGGTTCCAGCTCGCACGCTGGATCGATTCAACGATTCTGGACGCGCTT
TATGGCTGGGGCTTTGGCTGGAACCGGCCGCACACCAACTTTGACCCGCTGGTAGGGTTGAACAACGCCT
TCGGCGACATGCTCCTGATGTTCGTCATGGGCACGATGTTCCTGGTTCTGCCGGGATTCTGGCTGGCGAG
CCTTACCTGGGTTGGGATTCGGGCCGGGCACGTCATCCAGGGACTTTCCGATGGCAGCAAGAGCGCCGGC
CAAGCTGGCGGCAAGGGTGCCGGGGCGCTCACCGGAGGAAAACTGAAATAG
 Primer design