SecReT4
Protein ID: 218891374
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26481
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2844879..2846276 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDB7V520
KEGG IDpag:PLES_26481
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|218891374|ref|YP_002440241.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MKFRPAFNPFSRRVRRTEIVLALAGALALGSGVAWGQLGYQTSGSVIGDDVMYSIGGGNAVSMGRAAGMR
SIGVGVGWNSNLICGDMSIQTTLKNQLNGITNGFQQIMSSVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGLALRDAVSSTDAVSAIEQAETRRGNDGVPWV
GGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPASCSSLSCQTWTSPQAAVEWATRVLGEKEQ
RTCDACTKTETTPGVGLTPLIQEEYDAKLQALQDLVTKAKNTTPENLREAGSASLPITRGVIEALRDEPD
QHLLSQRLASEVALASVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGARAAGSRGIYEGDPVPDRLDQLQKGNPGSRP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2846276-2844879 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAAGTTCCGTCCTGCATTCAATCCGTTCTCCCGCCGGGTACGTCGCACGGAGATCGTCCTGGCACTGG
CCGGCGCGCTCGCGCTGGGCAGCGGCGTGGCCTGGGGTCAACTGGGATACCAGACCAGCGGCAGCGTCAT
CGGCGATGACGTCATGTACTCGATCGGTGGCGGCAACGCCGTGTCGATGGGACGTGCAGCCGGCATGCGC
TCCATCGGTGTCGGCGTGGGTTGGAACAGCAACTTGATCTGCGGCGACATGAGCATCCAGACCACGTTGA
AGAACCAACTTAACGGCATTACCAACGGCTTCCAGCAAATCATGTCGTCGGTGATCCAGAGTGCCACCAG
TGCGGTGGCATCGTTGCCCGCACTGATCATCCAGCGGGCCGATCCCGGTCTGTACAACCTGCTCACCAAT
GGCGTGCTGCAGGCGCGGCTGGATTTCGACCGCAGCAAGCTGACGTGCCGTGCCATGGCCGAGAAGATGG
CCGAAACGGCGGGCGGCCAACTCGGCTGGAGCCAGATGGCCGAAGGGCTGGCGCTGCGCGATGCCGTGTC
GAGCACGGATGCGGTCTCGGCCATCGAGCAGGCCGAGACGCGCCGCGGCAATGACGGCGTGCCGTGGGTC
GGGGGCAGCAACGCGGGCGGCTCCGGCCAGCCCGCGATCAAGGTCGTCGGCGATGTCACCCGCGCTGGCT
ACAACCTGGTCAACGGCCGCGGCGTGACCGACACCTCGTCCATTGCGCCGGCCAGTTGCAGCAGTCTCTC
GTGCCAGACCTGGACCTCGCCGCAGGCTGCCGTCGAGTGGGCCACGCGCGTGCTCGGCGAGAAGGAGCAG
CGCACGTGCGATGCCTGCACCAAGACCGAGACGACGCCGGGCGTCGGGCTCACGCCGCTGATCCAGGAGG
AGTACGACGCCAAGCTGCAGGCGCTCCAGGACCTGGTAACCAAGGCCAAGAACACGACGCCGGAGAACCT
GCGCGAAGCTGGCAGTGCGTCGCTGCCGATCACGCGCGGCGTGATCGAGGCGCTGCGCGACGAGCCCGAC
CAGCACCTGCTGTCGCAGCGCCTCGCGTCCGAGGTCGCGCTGGCATCCGTGCTGGAGAAAGCGCTGCTGC
TGCAGCGCACGCTGCTCACGGGCAAGAAGGAGCCCAACGTCGCGGCGAACGAACTTGCCGTGGAGGCGGT
GAACCACGAGAGCGACACGCTCGACCGTGAGATTCGCAACCTCAAGACCGAACTGGAGCTGCGGCGCGAA
CTGGCGAACAACTCGCCCATGGCGATCATCCAGCGCCACGGCGCGCGCGCGGCCGGTTCGCGCGGCATCT
ACGAGGGCGATCCTGTGCCGGACCGTCTCGACCAGCTCCAGAAGGGCAATCCGGGGAGTCGGCCATGA
 Primer design