SecReT4
Protein ID: 218891375
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26491
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2846286..2847233 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDB7V521
KEGG IDpag:PLES_26491
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 7.1e-95, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|218891375|ref|YP_002440242.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTRPFDLMRRLRAGVASLLLLSATGSYALNTATIIGSVASPDCLEYRVVGICYWLYCTWTGCTVRTSIKV
RHYIPDAVVSSYSNTGENPWVEVQAMSTPNPSAQAGGDGTTNEDHENSLAKFKNADVIGHPGAEVFNQFV
SSSGYFCEGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALIPGRREVGARTTMNLWGNVYPRGGFLHQTD
DFKAGAVVAQRAGDVVTRRGQIHVYQPLLANSRDGYWPAGALMEGDASTGKWQELTPVLSSSCTVFPRSG
FLTQAQQGDYAWALWRPYACCERRGQVFLGSVDFL
 
Nucleotide Sequence: 948 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2847233-2846286 Pseudomonas aeruginosa LESB58 chromosome, complete genome
GTGACCCGACCATTCGACCTGATGCGCCGCCTGCGCGCTGGCGTGGCTTCGTTGCTGCTGCTCAGCGCCA
CGGGCAGCTACGCCCTCAATACAGCGACCATCATCGGCTCGGTGGCATCGCCCGATTGCCTCGAATACCG
CGTCGTCGGCATCTGCTACTGGCTCTACTGCACATGGACGGGCTGCACCGTGCGCACGTCGATCAAGGTG
CGCCACTACATCCCCGATGCAGTGGTGTCGTCGTACTCGAATACCGGAGAAAACCCCTGGGTCGAAGTCC
AGGCAATGAGCACGCCCAACCCGTCCGCCCAAGCTGGCGGCGACGGAACGACGAACGAGGATCACGAAAA
CAGCCTCGCCAAATTCAAGAACGCGGATGTCATCGGTCACCCCGGCGCAGAGGTGTTCAACCAGTTCGTC
TCTTCGTCAGGCTACTTCTGTGAGGGCGCGGGCACGGCGTTTATGCCGTACTTGCTCAGCACCCTGGATA
CGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAAGCGCTGATTCCGGGCCGGCGCGAAGT
CGGTGCCCGTACCACGATGAATCTCTGGGGCAACGTGTATCCCCGTGGCGGCTTCCTGCACCAGACCGAC
GACTTCAAGGCCGGCGCAGTGGTGGCCCAGCGTGCGGGCGATGTGGTCACGCGCCGCGGGCAGATCCACG
TCTATCAGCCGTTGCTTGCCAACTCCCGTGACGGCTACTGGCCGGCCGGCGCGCTGATGGAGGGCGATGC
CTCGACCGGCAAGTGGCAAGAACTCACGCCCGTCCTGTCCTCGTCCTGCACGGTCTTCCCGCGCAGCGGC
TTCCTTACCCAGGCCCAGCAAGGCGACTACGCATGGGCGCTGTGGCGGCCGTATGCCTGCTGCGAGCGCC
GGGGCCAGGTGTTCCTGGGCAGCGTCGATTTCCTCTGA
 Primer design