SecReT4
Protein ID: 218891382
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26561
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2855626..2855958 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDB7V528
KEGG IDpag:PLES_26561
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 5.2e-38, Aligned region: 1..107
Protein Sequence: 110 a.a.     [Download]
>gi|218891382|ref|YP_002440249.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIAIAPTFVVLGVALGVFIGGGILRRLKRGRPDTWLYR
QLQWRIATRHPLMAGWVGGHVLISRSGFWSTRRSVARGAR
 
Nucleotide Sequence: 333 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2855958-2855626 Pseudomonas aeruginosa LESB58 chromosome, complete genome
GTGCGCGGCCTCACCGCCGACGAACTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCTGCTGGTCG
GCGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCCATCGCGCCGACGTTCGTCGTCCTGGGCGTGGCCCT
GGGCGTCTTCATCGGCGGCGGCATCCTGCGCCGGCTCAAGCGCGGGCGCCCCGACACCTGGCTGTACCGG
CAACTGCAATGGCGCATCGCCACGCGCCATCCACTGATGGCGGGATGGGTAGGCGGCCACGTGCTGATCT
CGCGCTCCGGCTTCTGGTCCACCCGAAGGTCCGTTGCAAGGGGGGCACGATGA
 Primer design