SecReT4
Protein ID: 218891383
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26571
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2856049..2856408 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDB7V529
KEGG IDpag:PLES_26571
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 4.7e-34, Aligned region: 32..118
Protein Sequence: 119 a.a.     [Download]
>gi|218891383|ref|YP_002440250.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MHNRILTSRLAQRAAMALGAAALPALSFAQGLPQLENPTRGTGNGIMETIRNYGYDIIMLVALLVVASMF
IGVCYHAYGTYAEIHTGRKTWGQFGLTVAIGAVLLVIGIWLLTEATGIL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2856408-2856049 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCACAACCGCATCCTCACTTCCCGTCTCGCCCAGCGCGCCGCCATGGCCCTGGGCGCCGCCGCGCTGC
CCGCGCTGTCGTTCGCGCAAGGCCTGCCGCAGTTGGAGAACCCGACCCGCGGCACCGGCAACGGCATCAT
GGAAACGATCAGGAACTACGGCTACGACATCATCATGCTCGTAGCCCTCCTGGTCGTGGCGTCGATGTTC
ATCGGCGTCTGCTACCACGCCTACGGCACCTACGCGGAAATCCACACCGGCCGCAAGACCTGGGGCCAGT
TTGGCCTCACCGTCGCGATCGGTGCCGTGCTGCTCGTGATCGGCATCTGGCTGCTCACCGAAGCCACCGG
CATCCTGTAA
 Primer design