SecReT4
Protein ID: 218891385
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26591
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2856655..2857038 [-]
Productplasmid Ignore, RAQPRD family
Component typeTfc9
UniProt IDB7V531
KEGG IDpag:PLES_26591
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.2e-30, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|218891385|ref|YP_002440252.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MVASIWLRAAHRGVPTFLVTALLLGQSQMALAESPAQRQELVAALRQLDALERTVADSAAHAPIQPGERY
HFDYPRLLADLARVRAGIQFHLTPSRAQPRDPSELAGDYRTERAAEPLPATTAGGKQ
 
Nucleotide Sequence: 384 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2857038-2856655 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGTGGCTTCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCCTGC
TGGGTCAGTCCCAGATGGCCTTGGCCGAGTCTCCGGCACAGCGCCAGGAGCTGGTCGCCGCACTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCGGACAGCGCCGCGCATGCCCCCATCCAGCCGGGCGAGCGCTAC
CACTTCGACTACCCGCGGCTGCTGGCTGACCTGGCGCGCGTTCGCGCCGGCATCCAGTTTCACCTGACGC
CATCGCGCGCTCAGCCGCGCGACCCCTCCGAACTGGCCGGCGACTACCGCACCGAGCGGGCGGCCGAGCC
GCTGCCGGCGACGACTGCGGGGGGCAAGCAATGA
 Primer design