SecReT4
Protein ID: 218891395
T4SS name [ID]Tfc [759]
Gene symbol-
Locus tagPLES_26691
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T4SS(s) in this replicon]
Location [Strand]2868006..2868575 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDB7V541
KEGG IDpag:PLES_26691
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|218891395|ref|YP_002440262.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MPLRALVLTAGLYAVAALAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRLVPWPWSLNVAGQS
RRFATRADACAGLQQAMRATPHTRIDAGLGQINLGYHKHRFTGACDLLDPYRNLAVAAEILKEQHTPGED
WLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPAAAVLAARQETSP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2868575-2868006 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCCCCTGCGCGCACTGGTGCTCACTGCCGGCCTGTATGCCGTTGCCGCCCTGGCCCAGGAGGTTCCGC
CACCGGCTTACCAGCTTGCCGCCCAGCGCGCAGGCATCCCCTCGACCGTGCTCTACGCCGTGGCCTTGCA
GGAGAGCGGCATCCGGCGCAACGGGCGCCTGGTGCCGTGGCCGTGGTCCCTCAACGTCGCCGGCCAGTCG
CGCCGCTTCGCCACGCGCGCCGACGCCTGCGCTGGCCTGCAGCAGGCGATGCGCGCCACGCCGCACACGC
GCATTGATGCGGGCCTGGGCCAGATCAACCTCGGCTACCACAAGCACCGCTTTACCGGCGCGTGCGACCT
GCTGGATCCGTATCGCAACCTGGCCGTTGCCGCCGAGATCCTGAAGGAGCAGCACACCCCCGGCGAGGAC
TGGCTGCTGGCGATCGGCCGCTACCACCGCCCCGCAGGCGGCGAGCCCGCCGCCCGCTATCGGCGCAGCG
TGTCGCGCCACCTTGCCCGCGTGCAGGGCACGCGACCAGCCGCCGCGGTCCTCGCGGCGCGCCAGGAGAC
CTCCCCATGA
 Primer design