SecReT4
Protein ID: 219586095
T4SS name [ID]Tra_F [110]
Gene symboltraL
Locus tagpO26I_p048
StrainEscherichia coli plasmid pO26-L (NC_011812)
Repliconplasmid pO26-L [GenBank: NC_011812] [Browse all T4SS(s) in this replicon]
Location [Strand]29633..29944 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDQ6SJ25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|219586095|ref|YP_002456189.1| conjugal transfer pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|219586047|ref|NC_011812.1|:29633-29944 Escherichia coli plasmid pO26-L, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design