SecReT4
Protein ID: 219586116
T4SS name [ID]Tra_F [110]
Gene symboltraF
Locus tagpO26I_p069
StrainEscherichia coli plasmid pO26-L (NC_011812)
Repliconplasmid pO26-L [GenBank: NC_011812] [Browse all T4SS(s) in this replicon]
Location [Strand]43804..44580 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB8XWR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.7e-79, Aligned region: 34..248
Protein Sequence: 258 a.a.     [Download]
>gi|219586116|ref|YP_002456210.1| conjugal pilus assembly protein TraF [Escherichia coli]
MMKEKMMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQ
TATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAAD
QAQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQ
RLGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 777 bp     [Download]
>gi|219586047|ref|NC_011812.1|:43804-44580 Escherichia coli plasmid pO26-L, complete sequence
ATGATGAAAGAAAAAATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCT
TTATTTTTCCGGCGTCAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAA
AGAAAATAAACCTGTACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAG
ACGGCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCC
GGCTGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACA
TCCCGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGAC
CAGGCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGC
AGGACCCCATCGACGGGCAACTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTAT
TCCCGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAG
CGCCTCGGTGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTAT
CATACGGCTTTATTTCACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAA
TTTTTAA
 Primer design