SecReT4
Protein ID: 219586118
T4SS name [ID]Tra_F [110]
Gene symboltraQ
Locus tagpO26I_p071
StrainEscherichia coli plasmid pO26-L (NC_011812)
Repliconplasmid pO26-L [GenBank: NC_011812] [Browse all T4SS(s) in this replicon]
Location [Strand]45057..45341 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ6SJ04
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 5.7e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|219586118|ref|YP_002456212.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKYRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|219586047|ref|NC_011812.1|:45057-45341 Escherichia coli plasmid pO26-L, complete sequence
ATGATAAGTAAATACAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design