SecReT4
Protein ID: 220916240
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1133
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1267069..1267719 [+]
Productlytic transglycosylase
Component typeTrwN
UniProt IDB8JFP0
KEGG IDacp:A2cp1_1133
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.8e-14, Aligned region: 19..146
Protein Sequence: 216 a.a.     [Download]
>gi|220916240|ref|YP_002491544.1| lytic transglycosylase [Anaeromyxobacter dehalogenans 2CP-1]
MTGLSALIVACGIVRHVGLIEAIVRVESGGNPFALAVNGAVELVHAPRDRDEAAAMARWLAAHGYNFDAG
LAQVNSANLARFGLDTSSVFERCANLRAASRVLEECHERALQHWDDEERAMAAALSCYNTGHLTRGLRNG
YVTAVRAAVDSLAPGPNRDGSRGDEACHVWGRSARRNPARGSGRARAAIGDTQRDEVFAMSLADAFATRS
HEERVR
 
Nucleotide Sequence: 651 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1267069-1267719 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
GTGACCGGCCTCAGCGCGCTCATCGTCGCATGCGGAATCGTACGCCACGTCGGCCTGATCGAGGCCATCG
TCCGGGTGGAGTCCGGCGGCAATCCGTTCGCGCTCGCGGTAAACGGCGCAGTGGAACTGGTGCACGCGCC
TCGCGATCGGGACGAAGCTGCGGCGATGGCCCGATGGCTCGCGGCGCACGGCTACAACTTCGACGCCGGG
CTCGCGCAGGTGAACAGCGCCAACCTGGCGCGGTTCGGACTCGACACCTCCAGCGTGTTCGAGCGCTGTG
CGAACCTCCGTGCAGCGAGCCGCGTGCTCGAGGAATGTCACGAGCGCGCGCTCCAGCACTGGGACGACGA
GGAGCGCGCGATGGCGGCAGCGCTCTCCTGCTACAACACGGGCCACCTCACGCGCGGATTGAGGAACGGC
TACGTGACCGCGGTGCGAGCGGCCGTGGACTCGCTGGCGCCGGGGCCAAATCGCGACGGATCGCGCGGCG
ACGAAGCCTGCCACGTGTGGGGTCGCTCCGCGCGCCGCAACCCGGCGCGCGGGAGCGGCCGGGCGCGGGC
AGCGATCGGCGACACCCAGCGGGACGAAGTGTTCGCGATGTCGCTGGCGGATGCCTTCGCCACGCGCTCG
CACGAGGAGCGGGTGCGATGA
 Primer design