SecReT4
Protein ID: 220916242
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1135
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1268172..1268447 [+]
Productconjugal transfer protein Trbc
Component typeTrwL
UniProt IDB8JFP2
KEGG IDacp:A2cp1_1135
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-10, Aligned region: 8..89
Protein Sequence: 91 a.a.     [Download]
>gi|220916242|ref|YP_002491546.1| conjugal transfer protein Trbc [Anaeromyxobacter dehalogenans 2CP-1]
MAAVFKRFVFTVALASSATNTEAQGLSRARSTLQNFQSELMLFVPIVAVVSLIILAILWGLRIIHFRTLA
QWGGGVLIVGAASQLVNMLLS
 
Nucleotide Sequence: 276 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1268172-1268447 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGGCGGCGGTGTTCAAGCGATTCGTGTTCACGGTGGCACTGGCATCTTCGGCGACGAATACGGAGGCGC
AGGGGCTCTCGCGGGCACGCTCGACCCTGCAGAACTTCCAGTCCGAGCTCATGCTGTTCGTGCCGATCGT
CGCGGTCGTCTCGCTCATCATCCTCGCGATCCTCTGGGGCCTGCGGATCATCCACTTCCGGACGCTCGCG
CAGTGGGGCGGCGGCGTCCTGATTGTGGGCGCCGCGAGCCAGCTCGTGAACATGCTGCTCTCCTGA
 Primer design