SecReT4
Protein ID: 220916246
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1139
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1272603..1273298 [+]
ProductP-type DNA transfer protein VirB5
Component typeTrwJ
UniProt IDB8JFP6
KEGG IDacp:A2cp1_1139
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5e-49, Aligned region: 23..203
Protein Sequence: 231 a.a.     [Download]
>gi|220916246|ref|YP_002491550.1| P-type DNA transfer protein VirB5 [Anaeromyxobacter dehalogenans 2CP-1]
MKHLRTLVVAGGFAFATAAHAQGIPVFDSSSFGQMVLSVKALGDQLRQLQATYQAVSGTRNLGEVLYNPA
LRGYLPADWARVYDTAAAGGYPGISGPLRAVQDGERLRGTVTDAQASIAARSRTTAMADKATGLHAFEGA
RARLSQIEQLMRQINLTHDAKGVQEIQARIAVEQAAVQNETTKLQLVAMLQRAEERLVEQQKTDLAQRIL
SASNRGMPPCCSVDPGAGARR
 
Nucleotide Sequence: 696 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1272603-1273298 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGAAACACCTCCGAACGTTGGTAGTCGCCGGAGGCTTCGCGTTCGCGACCGCGGCGCACGCGCAGGGCA
TCCCGGTGTTCGACTCGTCGAGCTTCGGTCAGATGGTTCTGTCGGTGAAGGCGCTTGGGGATCAGCTCAG
ACAGCTCCAGGCCACGTACCAGGCCGTGAGCGGAACCCGTAACCTCGGTGAAGTGCTCTACAACCCGGCG
CTCCGAGGTTACCTGCCGGCGGACTGGGCGCGCGTTTACGACACCGCGGCCGCAGGAGGCTACCCCGGGA
TCTCCGGGCCACTCCGGGCCGTCCAGGACGGTGAGCGGCTTCGCGGCACCGTCACCGACGCGCAGGCGAG
CATCGCGGCTCGGAGCCGGACGACAGCGATGGCCGACAAGGCTACGGGCCTGCATGCGTTCGAGGGTGCG
CGGGCGCGCCTCTCCCAGATCGAGCAGCTCATGCGGCAGATCAACCTCACGCACGATGCCAAGGGCGTAC
AGGAGATCCAGGCGCGCATCGCGGTGGAGCAGGCCGCGGTGCAGAACGAGACGACGAAGCTCCAGCTCGT
CGCCATGCTCCAGCGCGCTGAGGAGCGGCTCGTCGAGCAGCAGAAGACCGACCTCGCGCAACGGATCCTC
TCCGCATCCAACCGCGGGATGCCGCCGTGCTGCTCGGTCGACCCGGGCGCGGGCGCGCGGAGGTGA
 Primer design