SecReT4
Protein ID: 220916248
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1141
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1274172..1274363 [+]
ProductVirBTraTrw family protein
Component typeTrwH
UniProt IDB8JFP8
KEGG IDacp:A2cp1_1141
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|220916248|ref|YP_002491552.1| VirBTraTrw family protein [Anaeromyxobacter dehalogenans 2CP-1]
MRPLLFIALACACATAPGPKRPDESHRVPVNRRVPPEVEEAVRANHASGAQRQPRPEGEVEWR
 
Nucleotide Sequence: 192 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1274172-1274363 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGAGGCCGCTCCTGTTCATCGCGCTGGCCTGCGCCTGCGCCACGGCGCCCGGACCCAAGCGGCCAGACG
AGTCCCACCGGGTCCCCGTGAACCGGAGGGTGCCGCCCGAGGTGGAAGAGGCCGTGAGGGCGAACCATGC
CAGCGGAGCGCAGCGGCAACCGCGACCCGAGGGCGAGGTGGAGTGGCGATGA
 Primer design