SecReT4
Protein ID: 220916249
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1142
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1274360..1275037 [+]
ProductVirB8 family protein
Component typeTrwG
UniProt IDB8JFP9
KEGG IDacp:A2cp1_1142
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.3e-58, Aligned region: 14..220
Protein Sequence: 225 a.a.     [Download]
>gi|220916249|ref|YP_002491553.1| VirB8 family protein [Anaeromyxobacter dehalogenans 2CP-1]
MRAGDLEQYLEESRGLERDYLEELVRSRRVAWRVAASAAVLVAAALATVVALVPLKRVEAFVLRVDNATG
AVDLVTTLRDGQAGYGEVVDRYFLNKYVLARESYDYETLQTAYDTTALMSSGEVQREYAGLFDGPKARDK
VLANRVRIVVKVRSIAPGTTRNTAVVRFATRAAHADGTSEAEESLVATIGFRYVGGAMHEQDRLVNPLGF
QVTSYRVDPEIAGGG
 
Nucleotide Sequence: 678 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1274360-1275037 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGAGGGCGGGGGACCTGGAGCAGTACCTCGAGGAGAGCAGGGGGCTTGAGCGCGACTACCTCGAGGAGC
TCGTGCGCTCGAGGAGGGTGGCGTGGCGGGTGGCGGCGAGCGCGGCCGTGCTAGTAGCGGCCGCGCTCGC
CACGGTGGTGGCGCTGGTCCCGCTGAAGCGCGTCGAGGCGTTCGTGCTGCGGGTCGACAACGCCACGGGA
GCGGTGGATCTGGTGACGACGCTCCGCGACGGGCAGGCGGGCTACGGCGAGGTGGTCGACCGGTATTTCC
TCAACAAGTACGTCCTCGCCCGGGAGAGCTACGATTACGAGACGCTCCAGACCGCGTACGACACGACCGC
GCTCATGAGCAGCGGCGAGGTCCAGCGCGAGTACGCGGGGCTTTTCGACGGGCCGAAGGCGCGGGACAAG
GTCCTCGCGAACCGCGTCCGGATCGTCGTGAAGGTCCGTTCAATCGCGCCTGGCACGACCCGCAACACCG
CGGTCGTGCGATTCGCGACGCGCGCGGCGCACGCCGATGGGACGAGCGAGGCGGAGGAGAGCCTCGTCGC
CACCATCGGATTCAGGTACGTGGGCGGCGCCATGCACGAGCAGGACCGGCTCGTGAACCCGCTCGGTTTC
CAGGTGACGAGCTATCGGGTCGATCCCGAGATCGCGGGCGGCGGGTGA
 Primer design