SecReT4
Protein ID: 220916250
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1143
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1275050..1275823 [+]
ProductP-type conjugative transfer protein VirB9
Component typeTrwF
UniProt IDB8JFQ0
KEGG IDacp:A2cp1_1143
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.2e-59, Aligned region: 23..233
Protein Sequence: 257 a.a.     [Download]
>gi|220916250|ref|YP_002491554.1| P-type conjugative transfer protein VirB9 [Anaeromyxobacter dehalogenans 2CP-1]
MRRVIVLLLAIAVSAGASEGGPDRRIRYVSYDPDTVVPVDAVVGIVTHIVLEPGESYVTHAFGDGKAWDF
AAKANHFFLKAVAMNADSNLTIVTDRRSYHFSLRLLAEPKAAPTFEIAFRYPDTEARKRREVARRAAVDD
GFKGNGELPNLDYTMSGDLDLSPVNTWDDREFTYFKFPGQRDIPSIYTVDLDGNESIVNRHSTGPSNEIV
VVHKVAARWVLRLGSRALAIWNDAYDPGGRRNVSRTASPDVNRVLWR
 
Nucleotide Sequence: 774 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1275050-1275823 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGCGCCGCGTGATCGTTCTCCTTCTCGCCATCGCCGTGTCCGCCGGAGCCTCCGAAGGCGGGCCGGACC
GCCGGATTCGGTACGTGAGCTACGACCCGGACACCGTCGTCCCCGTGGACGCGGTGGTCGGCATCGTCAC
GCACATCGTCCTCGAGCCCGGCGAGAGCTACGTGACGCACGCGTTCGGCGACGGAAAGGCATGGGACTTC
GCCGCAAAGGCAAACCACTTCTTCCTCAAGGCGGTCGCGATGAACGCCGACTCGAACCTGACCATCGTCA
CCGACCGGCGGAGCTACCACTTCAGTCTCCGGCTCCTCGCGGAACCGAAGGCGGCGCCGACCTTCGAGAT
CGCCTTCCGCTACCCCGATACCGAAGCGCGGAAACGCCGCGAGGTTGCGCGGCGGGCCGCGGTCGATGAC
GGGTTCAAGGGCAACGGCGAGCTGCCGAATCTGGACTACACGATGAGCGGCGATCTCGACCTCTCGCCAG
TGAACACGTGGGACGACCGCGAATTCACGTACTTCAAGTTTCCCGGCCAGCGCGACATCCCGTCCATCTA
CACGGTGGACCTGGACGGCAACGAGTCGATCGTGAACCGCCACAGCACGGGACCGTCGAACGAGATCGTG
GTCGTCCACAAGGTCGCCGCCCGCTGGGTGCTCCGGCTCGGCTCGCGCGCGCTCGCCATATGGAACGACG
CGTACGACCCCGGGGGACGACGGAACGTGAGCCGGACGGCCTCGCCGGACGTGAACCGCGTGCTCTGGAG
GTAG
 Primer design