SecReT4
Protein ID: 220916251
T4SS name [ID]Trw [136]
Gene symbol-
Locus tagA2cp1_1144
StrainAnaeromyxobacter dehalogenans 2CP-1
Repliconchromosome [GenBank: NC_011891] [Browse all T4SS(s) in this replicon]
Location [Strand]1275826..1277016 [+]
Productconjugation TrbI family protein
Component typeTrwE
UniProt IDB8JFQ1
KEGG IDacp:A2cp1_1144
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7e-57, Aligned region: 204..382
Protein Sequence: 396 a.a.     [Download]
>gi|220916251|ref|YP_002491555.1| conjugation TrbI family protein [Anaeromyxobacter dehalogenans 2CP-1]
MAETIVDAAVELEKRERERARAEEAAPDVEGARGKALLAGARRQWPVGARTFFVVTGLVAVGLISVLLLK
ARSARREAEAREHESPAKTERVERHVPPLELAAQAPVPLQAPPAAVAVGAGGDAPGAIASPEAELVQRRL
SRGFGAGEGDGGPREQASSAAPHQSLAPDGAPAVPRRPGGLEEKLEAVELRAAAADVLPDRDHILTQGAM
LDCVLETRIVSTVAGMTSCHLTRDVYSTSGRVVLLDRGSRVVGRYQGGMQQGDTRVFVLWMRVETPAGVV
VELQSPGAGPLGEAGLGGHVDTRFWDRFGAAVLLSVIEDGVDAAAARAAGTAQGTSINVGNTANAGKEVI
ARSMEPTINIPPLLVKNQGERVGIFVARDLDFRSVYGLERFTRTGR
 
Nucleotide Sequence: 1191 bp     [Download]
>gi|220915123|ref|NC_011891.1|:1275826-1277016 Anaeromyxobacter dehalogenans 2CP-1 chromosome, complete genome
ATGGCGGAGACCATCGTCGATGCGGCGGTGGAGCTGGAGAAGCGCGAGCGGGAGCGGGCGCGCGCCGAGG
AGGCGGCGCCGGACGTCGAGGGGGCGCGCGGGAAGGCGCTCCTCGCGGGCGCCCGGCGGCAGTGGCCGGT
TGGGGCGCGGACGTTCTTCGTCGTCACCGGGCTCGTGGCGGTTGGGCTCATCTCCGTGCTGCTTCTCAAG
GCGCGCTCCGCGCGGAGGGAGGCCGAGGCGCGCGAGCACGAGAGCCCGGCGAAGACCGAGAGGGTTGAGC
GCCACGTGCCGCCGCTGGAGCTCGCCGCTCAGGCGCCCGTTCCGCTGCAGGCGCCACCTGCGGCGGTCGC
CGTAGGTGCGGGTGGCGACGCCCCCGGGGCCATCGCGAGCCCGGAAGCGGAACTCGTCCAGCGCCGCCTC
TCGCGCGGCTTCGGAGCGGGGGAGGGCGATGGAGGCCCCCGCGAGCAAGCCTCCTCGGCCGCGCCGCACC
AGTCGCTCGCACCCGACGGTGCGCCGGCGGTGCCGAGAAGGCCGGGCGGGCTGGAGGAGAAGCTGGAGGC
GGTGGAGCTCAGGGCCGCCGCGGCGGACGTCCTTCCCGATCGCGATCACATCCTCACGCAGGGCGCGATG
CTGGACTGCGTTCTGGAGACGAGGATCGTCTCGACCGTCGCGGGCATGACGTCGTGCCACCTGACTCGCG
ACGTCTACTCGACGAGCGGCCGGGTCGTGTTGCTCGACCGCGGCTCCCGCGTCGTCGGGCGTTACCAGGG
CGGCATGCAGCAGGGCGACACGCGCGTCTTCGTCCTCTGGATGCGCGTCGAGACGCCGGCCGGCGTAGTC
GTCGAGCTCCAGTCGCCGGGGGCGGGGCCGCTGGGCGAGGCGGGGCTGGGCGGCCACGTCGACACGCGAT
TCTGGGACCGGTTTGGCGCGGCCGTCCTCCTCAGCGTCATCGAGGACGGTGTGGACGCGGCTGCGGCGCG
CGCCGCAGGGACGGCGCAGGGTACGAGCATCAACGTCGGGAACACCGCGAACGCGGGGAAGGAGGTCATC
GCGCGGTCGATGGAGCCGACCATCAACATCCCGCCGCTGCTCGTAAAGAACCAGGGGGAGCGGGTCGGGA
TCTTCGTCGCGCGGGACCTCGACTTCAGGAGTGTCTATGGGCTGGAGCGCTTCACCCGCACCGGACGGTA
G
 Primer design