SecReT4
Protein ID: 220935051
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1882
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2004608..2005207 [+]
Productserine peptidase
Component typeTraF
UniProt IDB8GSQ9
KEGG IDtgr:Tgr7_1882
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1e-53, Aligned region: 50..194
Protein Sequence: 199 a.a.     [Download]
>gi|220935051|ref|YP_002513950.1| serine peptidase [Thioalkalivibrio sulfidophilus HL-EbGr7]
MTAVSTGANTAGKAPRPRSRLRARIVLAGLSACGLAALAWASFVHPLPRLIYNPSDSVAVGWYRVDPLGQ
GAGSLPRPLSVGNIILTTLPPDAAALAAQRGYLPARVPLLKRVGAIAPQEVCITGRIVRIDGVPSAAALP
ADRWSRPLPSWQQCRRLEPGELFLLSTTNPASFDSRYFGPVSASAVIGVAHPVWLESRP
 
Nucleotide Sequence: 600 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2004608-2005207 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGACTGCCGTTTCCACTGGTGCCAACACCGCCGGAAAGGCGCCGCGTCCTCGTTCCCGCCTGCGCGCTC
GCATCGTGCTTGCGGGCCTGTCCGCCTGCGGCCTCGCTGCGCTGGCCTGGGCGTCCTTCGTGCATCCGTT
GCCGCGTCTGATCTACAACCCGTCCGACAGTGTGGCGGTCGGCTGGTATCGCGTCGATCCGCTGGGCCAA
GGTGCCGGCTCGCTGCCACGTCCGTTATCCGTTGGCAACATCATCCTGACCACGTTGCCGCCAGATGCCG
CCGCGCTGGCCGCGCAGCGCGGCTACCTGCCGGCGCGCGTGCCGTTGCTCAAGCGCGTGGGCGCCATCGC
ACCGCAGGAGGTGTGCATCACTGGCCGCATTGTCCGCATCGACGGCGTGCCTTCGGCCGCCGCGCTGCCT
GCTGATCGCTGGAGCCGGCCGCTGCCATCTTGGCAGCAATGCCGTCGCCTCGAACCCGGCGAACTATTCC
TGCTCAGTACGACCAACCCGGCGTCGTTCGACAGCAGGTACTTCGGGCCGGTCAGCGCATCCGCCGTGAT
CGGCGTCGCGCATCCGGTCTGGCTGGAGTCTCGCCCATGA
 Primer design