SecReT4
Protein ID: 220935064
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1895
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2021276..2022346 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDB8GSW1
KEGG IDtgr:Tgr7_1895
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-81, Aligned region: 33..299
TrwB_AAD_bind [PF10412], Evalue: 1.7e-06, Aligned region: 151..192
FtsK_SpoIIIE [PF01580], Evalue: 8.5e-06, Aligned region: 153..215
Protein Sequence: 356 a.a.     [Download]
>gi|220935064|ref|YP_002513963.1| P-type conjugative transfer ATPase TrbB [Thioalkalivibrio sulfidophilus HL-EbGr7]
MSAVPQLPHEPRSSAAASLERRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLSSGRAPMGVEM
PEADGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVVDG
MMTAAQAGFLVQAVRERQNIVIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTR
AGVVSMTELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRMEQLILEVAV
NPPRALIAEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLADALETPFPELPLFPEAAPAAATSPSPD
QPGELP
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2021276-2022346 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAGTGCCGTTCCGCAACTCCCGCATGAGCCGCGTTCGTCTGCTGCCGCCTCCCTTGAGCGACGCATCC
AGATGCTGCGCACGGCAATGGGGCCGCTGATCGCCACCGCGCTCGAAGACCCCGACGTGGTGGAAATCAT
GCTCAACCCCGATCGCACCCTTTGGGTGGATCGGCTTTCGAGTGGGCGCGCGCCGATGGGCGTGGAGATG
CCCGAGGCCGATGGCGAGCGGATCATCCGCCTGGTCGCTGCCCACGTCGGCGCGGAAGTCCATCGCGGCC
AGCCGCTGCTGTCGGCTGAACTGCCGGAGACGGGCGAGCGATTCGAGGGCATCTTGCCGCCCGCCGCGCC
GGGGCCGGCCTTCGCGCTGCGCAAGCGCGCCATCGGCGTGATCCCGCTGGAGCGGTACGTCGTGGACGGA
ATGATGACCGCCGCCCAGGCGGGCTTTCTGGTGCAGGCCGTGCGCGAGCGCCAGAACATCGTGATCGCCG
GGGCCACCAGCAGCGGCAAGACCACGCTGGCCAATGCGCTGCTGGCAGAGATTGCCGCCACCGGCGACCG
CGTGTTGGTACTCGAAGACACGGTGGAGCTGCAATGCGCGGCGCGTGACCACGTTCCGCTGCGCACGCGC
GCGGGGGTGGTGTCCATGACCGAGTTGGTGCGCTCCTCCATGCGCCTGCGACCCGATCGCGTGGTGGTCG
GCGAGGTGCGCGGCGCCGAGGCGCTGGATCTCATCAAGGTGTGGGGCACCGGCCACCCCGGCGGCATCGC
CACGATCCATGCGGGTTCCGCGCTGGGCGCGTTGCTGCGCATGGAGCAACTGATTCTCGAAGTGGCGGTG
AACCCGCCGCGTGCGCTGATCGCCGAGGCGGTCAACGTGGTGATCCACATCGCCGGTCGCGGGCGCAAGC
GCCGCATCGAGAGCATCGCCCGCGTCGTCGGCTTCGACGGTGTGGGCTACCGATTGGCGGATGCGCTGGA
GACACCGTTTCCCGAGCTGCCGCTATTTCCCGAGGCCGCACCCGCTGCGGCGACTTCCCCGTCCCCTGAC
CAACCTGGAGAACTGCCATGA
 Primer design