SecReT4
Protein ID: 220935065
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1896
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2022343..2022735 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDB8GSW2
KEGG IDtgr:Tgr7_1896
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-24, Aligned region: 29..120
Protein Sequence: 130 a.a.     [Download]
>gi|220935065|ref|YP_002513964.1| Conjugal transfer protein TrbC [Thioalkalivibrio sulfidophilus HL-EbGr7]
MTQMIVPAFRFSANPALRLPARSRLHSLARPAAQGLLLAALLLLLAGTAQAAGSSMPWEGPLQSILESIQ
GPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 393 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2022343-2022735 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGACGCAGATGATCGTTCCTGCTTTCCGTTTTTCTGCAAATCCGGCTTTGCGCCTTCCCGCGCGGTCGC
GGCTGCACAGCCTGGCCCGCCCTGCGGCGCAAGGCTTACTGCTGGCCGCACTGCTGCTGTTGCTGGCTGG
AACCGCGCAGGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAG
GGGCCGGTGGCGCGCATCGTCGCCGTCATCATCATCATCGCCACGGGCCTCGCGCTGGCCTTCGGCGACA
CGTCAGGCGGCTTCCGCAAGCTGATCCAGATCGTGTTCGGCTTGAGCATCGCCTTCGCCGCGTCCTCGTT
CTTCCTGTCGTTCTTTTCGTTCTCTGGCGGGGCTGTCGTATGA
 Primer design