SecReT4
Protein ID: 220935067
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1898
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2023017..2025470 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDB8GSW4
KEGG IDtgr:Tgr7_1898
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3.5e-39, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 1.4e-17, Aligned region: 282..388
DUF853 [PF05872], Evalue: 6.1e-07, Aligned region: 613..684
Protein Sequence: 817 a.a.     [Download]
>gi|220935067|ref|YP_002513966.1| conjugal transfer ATPase TrbE [Thioalkalivibrio sulfidophilus HL-EbGr7]
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRTAADYPHSEFPEPLSWLVDEERRSAFEDTGHHFESGYHLTLVYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEIAWLDDSQTLTYLHSTISTRRYRMGVPEVPFHIDAL
LTDSPLVGGLAPMLGDRHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCLDKSEAERELGRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDEDAGAADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLALQFRRYRGSRIFAFDMGRSMRATILGLG
GEHYDLGTDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPDEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLAN
PQATEPQIRTIYEGFGLNRRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIDR
VLLDAGTPGFAGAWLRHRGLDWAADLLPSFPGLAPGSLADHPQENLP
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2023017-2025470 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCCAACGGCCCGCGCTGCTCGCCGACTGGCTGCCCTGGGCCGGACTGG
TCGCGCCGGGTGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACCGCCCGGTTTCGCGGGCCTGACCT
CGATAGCGCCACGCAAGGCGAGCTGATCGCCACGTCGGCACGCCTGAACAACGCGCTGCGCCGGCTGGGT
TCTGGCTGGGCGCTGTTCATCGAGGCCGAGCGCCGCACCGCTGCCGACTACCCGCACTCGGAGTTTCCCG
AGCCACTTTCGTGGCTGGTGGACGAAGAACGCCGCTCGGCCTTCGAGGATACCGGCCATCACTTCGAGAG
CGGCTATCACCTGACGCTGGTGTACCTGCCGCCCGAGGAATCGCGCGCCCGTGCCGCCAAGATGCTCTAC
GAGAACACGCCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGGG
TCTTTGACCTGCTCGATGGCGTCATGCCGGAAATCGCCTGGCTCGATGACAGCCAGACGCTGACCTATCT
GCACTCGACCATCTCGACGCGGCGCTATCGCATGGGCGTTCCCGAGGTGCCGTTCCACATCGACGCGCTG
CTGACCGACTCGCCGCTGGTCGGTGGCCTGGCCCCCATGCTGGGCGACAGGCACCTGCGCGTGGTGTCGG
TGCGCGGATTCCCGACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTGGGATTTGGGTATCG
CTGGAGTACGCGCTTTCTGTGCCTCGACAAATCCGAGGCGGAACGGGAATTGGGGCGTCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCATCGCGCTGCTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCGAACAACAAGGCGGCGGACGCGGATGCGGCCTTGCAGGAGCTGGGCAGCGATCAGGT
CGCCTTCGGCTACCTGACGGCGACCGTCACCGTCATGGACGAGGACGCCGGCGCAGCCGACGAGAAGCTG
CGCATGGTGGAGCGCGTCATTCAGGGGCGCGGCTTCGTCACCATCCCCGAAACGCTCAATGCCGTGGATG
CGTGGCTGTCCTCGCTTCCCGGCAACGCCTACGCCAACGTGCGTCAGCCCATCGTCTCGACGCTGAACCT
GGCGCACATGATGCCGGTGTCGGCGGTGTGGGCCGGGCCGGAGAAGAACGACCACCTGGACGGCCCGCCG
CTGATCGTCACCCGCACCGATGGCGCGACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCCGGCCCGACCGGCATGGGCAAGTCGGTCTTGCTCGCCACGCTGGCGTTGCAGTTTCGCCG
CTATCGCGGCTCGCGCATCTTCGCCTTCGACATGGGGCGTTCCATGCGCGCCACGATCCTCGGGCTGGGC
GGCGAGCACTACGACCTGGGCACGGATGGAGAAATCGCCTTCCAGCCGCTCGCGCGCATCGACCGCGAGG
GCTACCGCACCTGGGCAGCGGAATGGATCGAAGGCCGCTTGCTGCACGAAGGCGTGGCAGTCGGCCCGGA
CGAGAAGGCGGCCATCTGGTCGGCACTCGGCAGCCTTGCCGGTGCGCCGGTGGAGCAGCGCACGATGACC
GGGCTGTCCGTCCTCTTGCAGTCCAACGCGCTGCGCCAGGCGCTCGCGCCGTATGTGCTGGGCGGCGCGC
ACGGCAAGCTGCTGGACGCCGACCACGACCGGCTGGGCATGGCCGACGTGCAGTGCTTCGAGATGGAAGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCGCGCTTCGACGAACGCTTT
GACGGTGCGCCCACGCTGCTGATCCTCGATGAAGCGTGGCTGTTCCTCGATGACCCGGTGTTTGCCGCGC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAGAACGTCAGCGTCATCTTCGCAACGCAGTCGCTGGC
CGACATCAAGGATTCGAGCATCGCGCCCGCGATCATCGAGAGCTGCGCGAGCCGCATTTTCCTCGCCAAC
CCGCAGGCGACCGAGCCGCAGATTCGCACGATATACGAGGGCTTCGGCCTCAACAGGCGTCAGATCGAAA
TCGTCGCCACCGCGCAGCCCAAGCGCGATTACTACTACCAATCCCGCCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGGCCGGCGGCGTTGGCGTTTGCGGGCGCTTCCACGCCGCAAGACCAGCGCGACATAGACCGC
GTGCTGCTGGACGCCGGCACGCCCGGCTTCGCGGGCGCCTGGCTGCGCCATCGCGGCCTCGATTGGGCGG
CTGACCTGCTGCCCTCGTTCCCCGGCCTCGCGCCGGGTTCCCTCGCTGACCACCCACAGGAGAACCTGCC
ATGA
 Primer design