SecReT4
Protein ID: 220935070
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1901
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2026521..2027903 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB8GSW7
KEGG IDtgr:Tgr7_1901
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-47, Aligned region: 37..264
Protein Sequence: 460 a.a.     [Download]
>gi|220935070|ref|YP_002513969.1| conjugal transfer protein TrbL [Thioalkalivibrio sulfidophilus HL-EbGr7]
MNDVTIIDQFLNTFAAYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGLDAGGPIFLQLDDMMGFPEVF
LNLDAILVLFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVASGVK
VLVLAVIVGIGSGLFTQFQVHPDEPSLDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
IGAAGTAVAVGAAATGVGSAVAAGARMAPAAAKLAGSGARAATSAAGSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQAAGRGAASRASAVGQRMAAPFRAGWNGAAADSGAGAASGQGVGEATPSASNAQTQEQPAW
AKRLHRRQQLTHAATTTAHALRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2026521-2027903 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAATTCCTCAACACATTCGCCGCCTACATCGACTCGGGTTTCGGGC
TGCTGCGGGGCGAAGTAGCGTTCCTCACGGCCACGCTGATCGTCATCGACATGACGATCGCCGGCCTGTA
TTGGGCCATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTTGCGG
GATTGGGTATCACCGCCACCGGCTCGGCAATCACGATGGAGAACTTCTTGCAGCCGGGCCGACTGGCGAA
AACCGGCCTTGACGCGGGCGGGCCTATCTTCCTTCAGCTTGACGACATGATGGGATTTCCCGAGGTGTTC
TTGAACCTCGATGCCATCTTGGTGCTGTTCCTCGCCTGGCTGGTCGTGGTGCTCTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAATTCAAGCTGACCACGCTCGCAGGCTTTGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACGAGCTTTCTGGCGGAAAAAGTGCTGGGCAACGTCGTGGCCTCCGGCGTCAAG
GTGCTGGTGTTGGCCGTGATTGTCGGTATCGGCTCGGGTCTGTTCACCCAGTTCCAAGTCCATCCCGATG
AGCCGTCCCTCGACCATGCGCTGGTCATCATGCTGGCCTCGCTCACTTTGCTGGCGCTGGGGATCTTCGG
CCCCGGCATCGCCACGGGCCTTGTGTCCGGTGCGCCGCAGCTCGGCGCGGGCGCGATGGCGGGCGCGGCC
ATCGGCGCAGCCGGAACGGCGGTGGCCGTCGGTGCCGCCGCGACGGGCGTGGGCAGTGCGGTAGCTGCTG
GCGCGCGCATGGCCCCGGCCGCCGCCAAGCTGGCCGGCAGCGGCGCGCGTGCCGCCACGTCGGCGGCGGG
CAGCGCGAAGTCGGCGTTCCAGGCCGGTTCCGCCGCAGCAGGCGGCGGTGCCAAAGGCGCGATGGCGGGC
TTGGGCAACGTCGCCAAGACCGGCGCGCAGGCAGCCGGACGAGGCGCTGCATCCCGTGCCTCCGCTGTCG
GGCAGCGCATGGCCGCTCCGTTCCGTGCTGGCTGGAATGGCGCTGCGGCCGACAGTGGCGCAGGGGCGGC
ATCCGGTCAGGGAGTTGGCGAGGCCACGCCCAGCGCCAGCAACGCGCAGACGCAGGAACAACCTGCCTGG
GCGAAACGACTGCATCGCCGCCAACAGCTCACCCATGCCGCGACCACCACCGCCCATGCGCTGCGCGGTG
GCGACGGCGGCGGCTCCGGCCAAGGGCCGAGCCTGCGCGATTCCGATTCATAA
 Primer design