SecReT4
Protein ID: 220935071
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1902
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2027916..2028620 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB8GSW8
KEGG IDtgr:Tgr7_1902
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-60, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|220935071|ref|YP_002513970.1| conjugal transfer protein TrbF [Thioalkalivibrio sulfidophilus HL-EbGr7]
MRFKKPQVRYADTPQPATPYQAAGQVWDDRIGSPRVQAKNWRLMAFGCLTLALLMAGGLVWRSAQSFVTP
YVVEVDNAGQVRAVGEAATPYKPSDAQTAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAAVLND
YARVNDPFARIGKESVTVQITSVVRASDTSFNVRWTERRYVNGAAAGLDRWTAVVSIVLQPPRTEERLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2027916-2028620 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGCGATTCAAGAAACCGCAGGTGCGTTACGCCGACACGCCGCAGCCTGCCACGCCGTACCAAGCTGCCG
GCCAGGTATGGGACGACCGTATCGGCTCGCCGCGCGTGCAGGCGAAGAACTGGCGCCTGATGGCCTTCGG
CTGCCTCACCCTCGCGTTGCTGATGGCCGGCGGCCTGGTGTGGCGCTCCGCGCAGTCCTTTGTGACGCCC
TACGTCGTGGAGGTGGACAACGCGGGCCAGGTGCGCGCAGTGGGCGAAGCCGCCACGCCATACAAGCCCA
GCGACGCACAGACCGCGTACCACCTAGGCCGCTTCATCGGCCTGGTTCGCTCGCTGTCCATCGACCCCAT
CGTCGTGCGCCAGAACTGGCTCGACGCCTACGACTACACGACCGACAAGGGCGCGGCCGTGCTCAACGAC
TACGCGCGGGTCAACGACCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTCG
TGCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACAGAACGCCGCTACGTCAACGGCGCCGCGGCGGG
ACTGGATCGGTGGACGGCCGTGGTGTCCATCGTGCTCCAGCCGCCGCGCACCGAAGAACGCCTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCCAAGC
CATGA
 Primer design