SecReT4
Protein ID: 220935072
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1903
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2028617..2029609 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB8GSW9
KEGG IDtgr:Tgr7_1903
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.5e-67, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|220935072|ref|YP_002513971.1| P-type conjugative transfer protein TrbG [Thioalkalivibrio sulfidophilus HL-EbGr7]
MNDLFRKSALPVILLALAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMPAQLKPAPEAE
DAKPVPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPYSDGALYQVYAAVGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTNRRTYLLELASTEKTWMASVSWEYPRDRM
LALQRQAQAASTAAPVDSGLSLENLRFRYAISGSNPPWKPLRAFDDGQKVYIQLPAGIAQGDLPPLFVIG
PEGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2028617-2029609 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCTTTGCCGGTGATCCTGCTTGCCTTGGCGGGCTGCGCCACGCAGG
GCAAACCGCCGCCGACCATCTCACTCGATGAGCCGGTACAGGCCCAGCCGCTGCCAGAGCCGCCCGCGCC
GGTAGAGGTGGTGGCCGTGCCCGAGGTACTGCCGATGCCCGCGCAGTTGAAGCCGGCTCCCGAAGCCGAG
GACGCCAAGCCTGTGCCGGAGCCGGCAGACGAGAAGGTGCGCGTTTCGCGTGCCAATGCCGAGGCGCGCG
TCGCGCCCACGCGCGAGGGCTACGTCAACGCTATTCAGGTGTGGCCGTATAGCGATGGTGCGCTCTATCA
GGTCTATGCGGCCGTGGGCCGCGTGACCGTGGTGTCGCTCCAGCCTGGCGAGGAACTAGTGACGGTGGCC
GCCGGCGATACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCAGCGGCGCCGACCTGCGCGTGAACG
TGCTGGTGAAGCCCATCCGCTCGGGCCTCAAGACCAATCTCGTCATCACCACCAACCGCAGAACGTACCT
GCTGGAGTTGGCTTCGACAGAAAAGACGTGGATGGCATCGGTGTCGTGGGAGTACCCGCGCGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAAGCGGCCAGCACCGCAGCGCCGGTCGATAGCGGCCTGTCGCTGGAGA
ACCTGCGCTTCCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTTCGACGACGG
GCAGAAAGTCTATATCCAGCTTCCCGCCGGCATCGCGCAGGGCGATCTTCCGCCGCTGTTCGTGATCGGG
CCGGAAGGCGACGGGCAATTGGTCAATTACCGCTTCCGCTCGCCGTACTACATCGTGGATCGGCTGTTCG
GAGCCGCCGAACTGCGCTTAGGTGGCGACAAGGGCGATGTGGTGCGAATCGAGCGCACGGATGGCGTGGC
ACGGAGGAACTGA
 Primer design