SecReT4
Protein ID: 220935073
T4SS name [ID]Trb [308]
Gene symbol-
Locus tagTgr7_1904
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2029612..2030886 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB8GSX0
KEGG IDtgr:Tgr7_1904
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.7e-57, Aligned region: 228..410
Protein Sequence: 424 a.a.     [Download]
>gi|220935073|ref|YP_002513972.1| conjugation TrbI family protein [Thioalkalivibrio sulfidophilus HL-EbGr7]
MSQDDTPDLATPQAGKVAPEAVALRAQPRPVTRLNRRTLAVLVGGLSVAVLGATIWSLQPQRRGANEQTE
LYNVDRVSKSEGLDGLPSDYSKLPPKVSELGPPLPGDLGPAIVNSQQPVTPTYVPPGHDPEDALRKEADA
AAASSVFFRSGGQSQAAATVTQAVPGASGGASTLAAFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLKA
GSTETRNSGNLALPVSPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGR
YNSQVSYGQSRVQVVWNRVILPDTSSLTLDSLVGTDPAGYAGLEDDVDWHWNRIVAGAVLTTLLGVGAEL
AAPENRQDGNRIVIAGRDSAQDSINQVGQEITRRNMNIQPTLTTRPGLPVRIIVNRDLVLRPYQPLFFNR
GASQ
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2029612-2030886 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAGCCAGGACGACACCCCCGACCTCGCCACGCCGCAGGCGGGCAAGGTCGCGCCCGAGGCGGTGGCGC
TGCGCGCCCAGCCGCGCCCGGTCACGCGCCTGAACCGGCGCACGCTGGCCGTCCTTGTCGGCGGCCTGTC
GGTCGCCGTGCTCGGGGCCACGATCTGGTCGCTGCAACCGCAACGGCGCGGCGCCAATGAGCAGACCGAG
CTTTACAACGTCGATCGCGTGTCGAAGTCCGAAGGGCTGGATGGCCTGCCTTCGGACTACTCGAAGCTGC
CGCCGAAGGTGTCCGAGCTGGGGCCGCCGCTGCCGGGTGATCTCGGCCCGGCCATCGTGAACTCGCAGCA
GCCGGTGACGCCGACGTATGTACCGCCGGGCCATGATCCCGAGGATGCCTTGCGCAAGGAGGCCGACGCG
GCAGCGGCCTCGTCGGTGTTCTTCCGCTCGGGCGGCCAAAGCCAGGCCGCCGCCACGGTGACGCAGGCGG
TGCCGGGTGCGTCTGGTGGCGCAAGCACGCTGGCGGCCTTTGACCCGCTCGCCGCTGGGCCGGCCTCGAC
GGCGGCCCAGCCTGCCGACCCGACCGCCGTGCAGAACCGGCAAGACCAGAAGGAGGCGTTCCTGAAAGCA
GGCTCTACGGAAACCCGCAATTCCGGCAATCTGGCGCTGCCGGTGTCGCCCTATCAGGTGATGGCCGGAA
CGGTGATCGCGGGCGCGCTGGTGACGGGCATCAAGTCCGACCTTCCGGGCGACGTGATCGCCACGGTGAC
GGAGCCGGTCTATGACACGGCCACGGGCAAGTTCCTGCTGATCCCGCAGGGATCGCGCATCCTCGGGCGC
TACAACAGCCAGGTCAGCTACGGGCAGAGCCGTGTGCAGGTGGTGTGGAACCGGGTCATCCTGCCCGATA
CGTCCTCGCTGACGCTCGACAGCCTTGTCGGCACCGACCCGGCCGGCTACGCCGGCCTGGAAGACGACGT
GGACTGGCATTGGAATCGCATCGTCGCGGGCGCGGTGCTGACGACGCTGCTGGGCGTGGGCGCCGAGCTG
GCTGCGCCGGAGAACCGTCAGGACGGCAACCGGATCGTCATCGCCGGGCGCGATAGCGCACAGGACAGCA
TCAATCAGGTCGGGCAGGAGATCACCCGGCGCAACATGAACATCCAGCCGACGCTGACCACGCGGCCGGG
CCTGCCGGTGCGGATCATCGTCAATCGGGATCTGGTGCTTCGGCCCTACCAGCCACTGTTCTTCAATCGG
GGAGCTTCGCAATGA
 Primer design