SecReT4
Protein ID: 220936004
T4SS name [ID]Tfc [715]
Gene symbol-
Locus tagTgr7_2843
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2982974..2983558 [+]
Productlytic transglycosylase
Component typeTfc4
UniProt IDB8GNM5
KEGG IDtgr:Tgr7_2843
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|220936004|ref|YP_002514903.1| lytic transglycosylase [Thioalkalivibrio sulfidophilus HL-EbGr7]
MAASVSLCRAGVLCLLCLAVWTAPVLAREIPPPAYQLAAHDAGIPSAVLYAVALQESGIALRGQRTPWPW
TLNVAGQARRFQTREAACANLRRALREVPATRIDVGLGQINLGYQAHRFDHPCELLDPYRNLAVAAAILR
EHHRPGDDWLLAIGRYHRPAGGAPAARYRRSVQKHLARVQGSPVPSIASRSHRP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2982974-2983558 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGGCTGCGTCAGTGAGCCTTTGCCGGGCAGGCGTCCTGTGCCTGCTCTGCCTCGCTGTCTGGACCGCGC
CCGTCCTGGCGCGGGAGATTCCGCCGCCGGCCTATCAACTGGCCGCGCACGACGCCGGCATTCCCTCGGC
GGTGTTGTACGCCGTGGCCTTGCAGGAAAGCGGCATCGCGCTGCGCGGGCAGCGAACTCCGTGGCCCTGG
ACCTTGAATGTCGCCGGCCAGGCACGGCGGTTCCAGACCCGCGAGGCCGCCTGCGCAAACCTGCGGCGCG
CGCTGCGGGAGGTGCCGGCGACGCGCATCGACGTTGGTCTGGGGCAGATCAACCTCGGCTACCAGGCGCA
CCGTTTCGATCACCCCTGCGAACTGCTGGACCCGTACCGGAATCTCGCGGTCGCCGCCGCGATCCTGCGC
GAACACCACAGGCCCGGCGATGACTGGCTGCTCGCCATCGGCCGCTATCACCGCCCCGCCGGTGGCGCAC
CGGCAGCCCGCTACCGCCGCAGCGTTCAAAAACATCTGGCGCGTGTGCAGGGCAGCCCGGTTCCGTCCAT
CGCATCGAGGAGTCATCGACCATGA
 Primer design