SecReT4
Protein ID: 220936007
T4SS name [ID]Tfc [715]
Gene symbol-
Locus tagTgr7_2846
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2986255..2987004 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDB8GNM8
KEGG IDtgr:Tgr7_2846
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|220936007|ref|YP_002514906.1| hypothetical protein Tgr7_2846 [Thioalkalivibrio sulfidophilus HL-EbGr7]
MSDPAVAAQRQQVRQRGFLASLVTLPFRFFGVLCGSLLLCILIEWIGMHLFWPEQGWRHAQDMVAYELDQ
LSTYFTRSVVVQEPGRTAHRVVEWAYEWVFLKTGLLEWVQNASAQASAGSHGQTRDFRYYLSQVYVHLES
YLIAAAYTVLVFLVRLLVLCLMLPLFLMAAFTGLVDGLVRRDIRRFGAGRESGFVYHRAKAALMPLVVLP
WAVYLALPISVSPILILLPSAVLLGVVVDIAAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2986255-2987004 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAGCGATCCGGCCGTCGCGGCGCAACGCCAACAGGTACGCCAGAGAGGTTTTCTCGCCAGCCTTGTCA
CCTTGCCGTTTCGCTTCTTCGGCGTGCTGTGCGGGTCGCTGTTGCTGTGCATCCTGATCGAATGGATCGG
CATGCACCTGTTCTGGCCGGAACAGGGATGGCGCCACGCGCAGGACATGGTGGCCTACGAGCTGGACCAG
CTATCGACCTACTTCACGCGCAGCGTGGTGGTGCAGGAACCGGGGCGCACCGCCCATCGGGTTGTCGAGT
GGGCGTATGAATGGGTCTTCCTCAAGACCGGGCTGCTGGAGTGGGTGCAGAACGCCTCCGCGCAGGCCAG
CGCCGGCAGCCACGGTCAGACCAGGGATTTCCGGTATTACCTGAGCCAGGTCTATGTCCACCTGGAAAGC
TATCTGATCGCGGCGGCGTACACGGTGCTGGTGTTCCTCGTGCGCCTGCTGGTGCTGTGCCTGATGCTGC
CGCTGTTCCTCATGGCGGCTTTCACGGGCCTCGTGGACGGCCTGGTGCGCCGTGACATCCGCCGCTTCGG
CGCGGGGCGCGAATCCGGCTTCGTCTATCACCGCGCCAAGGCGGCCTTGATGCCCCTGGTGGTACTGCCG
TGGGCGGTCTACCTCGCGTTGCCGATCAGCGTGAGCCCGATCCTGATTCTCTTGCCGAGTGCCGTGCTGC
TGGGCGTGGTCGTGGACATCGCGGCCGGAAGCTTCAAGAAATACCTGTAG
 Primer design