SecReT4
Protein ID: 220936012
T4SS name [ID]Tfc [715]
Gene symbol-
Locus tagTgr7_2851
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2993674..2994024 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDB8GNN3
KEGG IDtgr:Tgr7_2851
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 9.4e-30, Aligned region: 31..108
Protein Sequence: 116 a.a.     [Download]
>gi|220936012|ref|YP_002514911.1| hypothetical protein Tgr7_2851 [Thioalkalivibrio sulfidophilus HL-EbGr7]
MGHTNSHELARRLPIAALLAIPLLAFQASVFAGDATEPERLAVLMRQLDMLDRLAEHSERLPKQDASRYH
FDYARLREDIERVRSGIRDYLTPQRAQPRDPTTLIGDYRQEAEDAP
 
Nucleotide Sequence: 351 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2993674-2994024 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGGGACATACCAACAGCCACGAACTTGCCCGGCGTCTTCCGATCGCCGCGCTATTGGCTATCCCTCTAT
TGGCGTTCCAAGCCTCGGTGTTCGCCGGTGATGCTACGGAACCAGAGCGACTGGCCGTCCTCATGCGTCA
GCTCGACATGCTCGACCGGCTGGCCGAGCACAGCGAGCGCCTGCCGAAGCAGGACGCCTCCCGCTACCAC
TTCGACTACGCGCGGCTGCGCGAGGACATCGAGCGTGTCCGCAGCGGCATCCGCGACTACCTGACGCCGC
AGCGCGCACAGCCGCGCGACCCCACAACGCTGATCGGCGATTACCGCCAAGAGGCGGAGGACGCGCCATG
A
 Primer design