SecReT4
Protein ID: 220936015
T4SS name [ID]Tfc [715]
Gene symbol-
Locus tagTgr7_2854
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]2994655..2995053 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDB8GNN6
KEGG IDtgr:Tgr7_2854
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.3e-45, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|220936015|ref|YP_002514914.1| hypothetical protein Tgr7_2854 [Thioalkalivibrio sulfidophilus HL-EbGr7]
MSGSQDSLHDGTVAFLPHRLNRQPVVVRGLTADELWVCVGLSATVGLVLGIPLAWLASTLAMVPTVIVAA
IGMGVFVCGGALRSHKRGRPDTWLYRHLQWWVALRHPAFAPYTGGRSLVTRSGHWTTRRSAP
 
Nucleotide Sequence: 399 bp     [Download]
>gi|220933193|ref|NC_011901.1|:2994655-2995053 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGTCGGGGAGCCAGGACAGCCTGCACGACGGCACGGTGGCTTTCTTGCCGCATCGTCTGAACCGTCAGC
CCGTGGTGGTACGCGGACTGACGGCCGACGAACTGTGGGTCTGCGTAGGGCTCTCCGCCACGGTAGGCCT
GGTGCTGGGCATTCCGCTGGCGTGGCTGGCGTCCACGCTCGCGATGGTCCCAACCGTGATCGTGGCCGCC
ATTGGCATGGGCGTGTTCGTGTGCGGCGGCGCGTTGCGAAGCCACAAGCGGGGGCGTCCCGATACCTGGT
TGTACCGGCATCTTCAGTGGTGGGTCGCGCTGCGTCATCCCGCCTTCGCGCCCTATACGGGCGGCAGGTC
GCTGGTCACGCGGTCGGGCCACTGGACGACGCGCAGGAGTGCGCCATGA
 Primer design