SecReT4
Protein ID: 220936025
T4SS name [ID]Tfc [715]
Gene symbol-
Locus tagTgr7_2864
StrainThioalkalivibrio sulfidophilus HL-EbGr7
Repliconchromosome [GenBank: NC_011901] [Browse all T4SS(s) in this replicon]
Location [Strand]3004329..3005741 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDB8GNP6
KEGG IDtgr:Tgr7_2864
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 470 a.a.     [Download]
>gi|220936025|ref|YP_002514924.1| hypothetical protein Tgr7_2864 [Thioalkalivibrio sulfidophilus HL-EbGr7]
MSMSLFSHPFAMTRLARSILFAGVLAAMSNPLWAQTSVNDYGVHHRGSVIGDDVLYSIGGGRAVSMGPVG
QMQSLGVGIGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSQVIQNATAAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKLTCRAIANRMADAAGGQLGWDQLAEGMALKQAVASTDAVSAIEQAETSRGNDGV
PWVGGGNAGGAGQNPIRVVSDVTRAGYNLLNGRGATDTSPIDSITCGNRLSCQTWPSPQAATDWATRVLG
EQEHRTCDGCLKTQATAGVGLTPLIQEEYETRLEALRDLVTGASTTTFENLEVAGSASLPITRGVIEALR
DEPDQDVLARRLASEVALSSVLEKALLLQRTLLAGRKEPNVAANQLAQDAITHESSLLEQEINNLKTELD
LRRELAANSPMAIIQRHGTRSAGSRGIYQGDTERDRLDAIQRPQNPGNPP
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|220933193|ref|NC_011901.1|:3004329-3005741 Thioalkalivibrio sulfidophilus HL-EbGr7 chromosome, complete genome
ATGAGCATGTCCTTATTTTCACACCCCTTCGCCATGACGCGGCTGGCGCGCAGCATCCTGTTTGCCGGCG
TCCTGGCCGCCATGAGCAACCCGCTGTGGGCGCAGACCAGCGTCAATGACTATGGTGTACATCATCGCGG
CAGCGTCATCGGCGATGACGTGCTGTACAGCATCGGCGGCGGCCGGGCGGTATCGATGGGGCCGGTCGGC
CAGATGCAGAGCCTCGGTGTCGGCATCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACCA
CCACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACCATCATGAGCCAGGTGATCCAGAA
CGCCACGGCGGCCGTGGCGTCGCTGCCGGCGCTCATCATCCAGCGCGCCGATCCCGGTCTGTACAACCTG
CTGACCAATGGCATCTTGCAAGCACGGCTCGATTTCGATCGCTCAAAGCTCACCTGCCGCGCGATCGCCA
ACCGCATGGCCGACGCGGCGGGTGGTCAGCTCGGTTGGGATCAGTTGGCCGAGGGCATGGCGCTCAAACA
GGCCGTGGCCAGCACCGATGCCGTATCGGCCATCGAACAGGCCGAAACCAGTCGCGGCAACGACGGTGTG
CCCTGGGTCGGCGGCGGCAATGCCGGCGGCGCCGGACAGAATCCCATCCGCGTGGTCAGCGACGTGACCC
GCGCCGGCTACAACCTGCTCAACGGCCGCGGCGCTACCGATACGTCGCCGATCGACAGCATCACGTGCGG
CAATCGCCTGAGCTGCCAGACCTGGCCGTCTCCCCAAGCCGCCACCGATTGGGCAACCCGCGTGCTGGGT
GAGCAAGAGCACCGGACCTGCGATGGCTGCCTCAAGACCCAGGCGACCGCCGGCGTCGGCCTGACGCCAC
TGATCCAGGAGGAGTACGAAACCAGGCTGGAAGCGCTACGGGATCTGGTGACGGGTGCCAGCACGACCAC
GTTCGAGAACCTGGAAGTGGCCGGCAGTGCATCACTGCCGATTACGCGCGGCGTCATCGAGGCGCTGCGC
GACGAACCGGACCAAGATGTGCTCGCGCGTCGCCTGGCCTCCGAGGTCGCGCTGTCCAGCGTACTGGAGA
AGGCCCTGCTGTTGCAGCGGACACTGCTGGCCGGGCGCAAGGAGCCCAACGTCGCGGCCAACCAGCTCGC
ACAGGATGCCATCACACACGAAAGCAGCCTGCTGGAACAGGAGATCAACAACCTCAAGACCGAACTGGAC
CTGCGGCGCGAACTGGCGGCGAATTCGCCCATGGCGATCATCCAGCGGCACGGTACGCGCAGCGCCGGCT
CGCGCGGCATCTACCAGGGCGACACCGAGCGCGATCGTCTCGACGCCATCCAGCGGCCGCAGAACCCCGG
CAATCCGCCATGA
 Primer design