SecReT4
Protein ID: 221232081
T4SS name [ID]Tra_Tn [661]
Gene symbolorf15
Locus tagSPN23F_13020
StrainStreptococcus pneumoniae ATCC 700669
Repliconchromosome [GenBank: NC_011900] [Browse all T4SS(s) in this replicon]
Location [Strand]1274126..1276276 [+]
Productconjugative transposon membrane protein
Component typeOrf15_Tn
UniProt IDB8ZKI7
KEGG IDsne:SPN23F_13020
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 716 a.a.     [Download]
>gi|221232081|ref|YP_002511234.1| conjugative transposon membrane protein [Streptococcus pneumoniae ATCC 700669]
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYSRYPLENYQLD
FYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQEAYSLDFISATADSIGKNMQT
LAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRETTKAIHAIMNFVLVFILSASFIAYAPDYIKK
INDFSSDISNASLSLGTKIVMPHSDSQGKDSVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLL
STSPDSNNGEDREKIVAEEIEDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFII
YAMFLPVSFILSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGSAIVTGKKGQS
GSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKEQVKDLPTNARYAVYQGKSKV
KENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEMKQVKQKKQPASSVHERPTTRQEQYHDEQTS
KQSNIQTSYKESQQAKQERPAVKSDFSSPKVERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQ
RVPLQNTRTTNQNRHH
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|221230948|ref|NC_011900.1|:1274126-1276276 Streptococcus pneumoniae ATCC 700669, complete genome
GTGAAACCATCAATAGTAAACAGAATAAAATCAAACTGGACGCTGAAACGTCTAGGTAAAGTGGCAATGA
CAGTGGCTTTCACACTTGTGATTGCCATTTTTCTTTTAGCCATGCTGGGAACGGTGGTTCAAGCTGCGGG
CTTGGTAGATGATACGGTCAATGTGGCAAATGAATACAGCCGATACCCACTTGAAAACTATCAACTGGAT
TTTTATGTGGATAATAGCTGGGGCTGGCTTCCGTGGAACTGGTCGGACGGGATTGGAAAACAGGTCATGT
ATGGACTATATGCCATTACCAATTTTATTTGGACAATCAGTTTGTATGTTTCCAATGCGACAGGTTACTT
AGTACAGGAAGCCTATTCCTTAGACTTCATTTCCGCTACAGCAGATTCCATTGGTAAGAATATGCAGACC
TTAGCTGGTGTGAGTGCAAACGGATTTTCAACAGAGGGTTTCTATGTTGGATTCCTCTTACTCTTGATTT
TGGTTCTTGGGGTTTATGTTGCCTATACGGGACTGATAAAGAGAGAAACCACAAAGGCAATTCATGCCAT
TATGAATTTTGTGCTGGTGTTTATCCTATCGGCTTCCTTTATTGCCTACGCTCCCGACTACATTAAAAAA
ATCAATGACTTTTCATCAGACATCAGTAATGCCAGTTTATCACTTGGCACGAAGATTGTCATGCCCCATT
CCGATAGTCAAGGCAAGGACAGCGTGGACTTAATCAGAGATAGCCTGTTTTCCATACAGGTTCAGCAACC
GTGGCTACTGCTTCAATACAACAGTTCAGACATTGAAAGTATCGGTATTGACCGTGTGGAAAGCCTGCTC
TCCACCAGCCCAGATTCCAACAATGGCGAAGACAGAGAAAAAATTGTTGCGGAAGAAATTGAAGACAGAA
GCAATACCAATCTAACCATTACAAAGACCATTAACCGTTTAGGTACAGTCTTCTTCCTATTTGTCTTCAA
TATTGGGATTTCCATATTTGTATTCCTATTAACAGGAATCATGATTTTCTCGCAGGTACTTTTTATCATC
TATGCTATGTTTCTGCCTGTGAGCTTTATTTTAAGCATGATTCCATCATTTGATGGTATGTCAAAACGAG
CCATAACAAAGCTCTTTAATACCATTTTGACACGAGCTGGAATCACATTGATTATTACGACAGCATTTAG
TATTTCAACCATGCTCTATACCTTATCGGCTGGTTATCCGTTCTTTTTGATTGCTTTTCTACAGATTGTG
ACCTTTGCAGGAATCTACTTCAAGCTGGGCGATTTAATGAGTATGTTTTCTCTACAGAGTAACGATTCTC
AAAGTGTGGGAAGTCGTGTGATGAGAAAACCTCGTATGCTTATGCACGCTCACATGCACCGTCTACAGCG
GAAACTTGGACGTTCCATGACTACTCTAGGGGCTGGGTCTGCCATTGTTACAGGTAAAAAAGGACAGTCG
GGTTCGGGGAGTTCTGCAAGGACACAAGCAGATCACTCCCGACCAGACGGAAAGGAAAAATCAACACTTG
GAAAACGTATCGGTCAAACCATCGGTACAGTAGCTGATACCAAAGACAGAATGGTAGACACTGCTAGTGG
TTTGAAAGAACAGGTTAAAGATTTGCCGACCAATGCAAGATATGCAGTATATCAAGGAAAATCCAAAGTA
AAAGAGAATGTCCGTGATTTAACCAGTAGTATTTCTCAAACCAAAGCGGACAGAGCCAGTGGACGCAAGG
AACAGCAGGAACAAAGGCGAAAAACCATTGCGAAGCGTCGCTCTGAAATGAAACAGGTCAAACAGAAAAA
ACAGCCTGCTTCTTCTGTTCATGAAAGACCGACTACAAGACAAGAACAATATCATGATGAACAGACCTCA
AAACAGTCTAATATTCAGACTTCATATAAGGAATCTCAACAAGCCAAACAAGAGCGTCCAGCAGTTAAGT
CCGATTTTTCAAGTCCAAAAGTGGAACGCCAAGGCAATACCGTTCAAGAAAAAACCGTTCAAAAGCCAGC
AACTTCAACCACTACAGCAGATAGAACTTCACAACGTCCAATCACAAAAGAACGTCCGTCTACTGTTCAA
AGAGTACCACTACAAAATACAAGAACCACCAATCAAAACCGCCACCATTAA
 Primer design