SecReT4
Protein ID: 221235441
T4SS name [ID]VirB [427]
Gene symbol-
Locus tagCCNA_02505
StrainCaulobacter crescentus NA1000
Repliconchromosome [GenBank: NC_011916] [Browse all T4SS(s) in this replicon]
Location [Strand]2654745..2655713 [+]
Producttype IV secretory pathway VirB11 ATPase
Component typeVirB11
UniProt IDB8GZI1
KEGG IDccs:CCNA_02505
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-90, Aligned region: 12..309
AAA_28 [PF13521], Evalue: 5.7e-05, Aligned region: 161..230
Zeta_toxin [PF06414], Evalue: 8.3e-05, Aligned region: 156..213
Protein Sequence: 322 a.a.     [Download]
>gi|221235441|ref|YP_002517878.1| type IV secretory pathway VirB11 ATPase [Caulobacter crescentus NA1000]
MSTGVYLAAYLAPLQPWLDRADVTDIWVNRPGEVWIETTKGVTSRLAAPDLTDQALQRLARQIAAASHQG
VSREQPLLSASLPNGARVQIIAPPATRGDLALAIRKHTLSDLSLSDLAIGGTLAPPALTGRADADAQLRA
LLSAGDVEGFLRTAIQRRKTIVLSGGTSSGKTTLLNALVKEIPAHERLVLIEDAPEIQLRHENAIGLIAA
RSDTGEAQVDAEDLLQASLRMRPDRILLGELRGREAFAFLRAVNTGHPGSITTVHADSPQGALDQIALLS
LLAGVDLGWDTVRNYVRQVVDIVVQLNRVGGGRKVTAVEFLC
 
Nucleotide Sequence: 969 bp     [Download]
>gi|221232939|ref|NC_011916.1|:2654745-2655713 Caulobacter crescentus NA1000 chromosome, complete genome
ATGAGCACGGGGGTCTATCTCGCCGCCTACCTGGCGCCGCTGCAGCCTTGGCTGGACCGCGCTGACGTCA
CGGACATTTGGGTCAACCGGCCCGGCGAGGTATGGATCGAGACCACCAAGGGGGTGACCTCACGCCTCGC
TGCGCCGGACCTCACCGATCAGGCGTTGCAGCGTCTGGCCCGCCAGATCGCCGCCGCCAGCCACCAGGGC
GTCAGTCGCGAACAGCCGCTGCTCAGCGCCAGTCTGCCAAACGGCGCCCGCGTACAGATCATTGCGCCGC
CAGCCACGCGCGGCGACCTTGCCCTGGCCATCCGCAAACACACGCTCAGCGACCTCAGCCTCAGCGACCT
CGCCATCGGCGGGACCCTGGCGCCCCCGGCCTTGACCGGTCGGGCCGATGCGGACGCTCAGTTGCGCGCC
TTGCTGAGCGCCGGCGACGTCGAAGGTTTTCTTCGAACCGCCATCCAACGCCGCAAGACGATCGTCCTGT
CGGGCGGCACGTCCTCGGGCAAAACCACCTTGCTCAACGCTCTGGTCAAGGAGATCCCGGCGCACGAGCG
CCTCGTCCTGATCGAAGACGCCCCCGAAATCCAACTGCGTCACGAGAACGCGATCGGCCTGATCGCCGCG
CGCAGCGACACGGGTGAGGCCCAGGTCGACGCCGAGGATCTCCTTCAAGCCAGCCTGCGGATGCGCCCTG
ACCGGATCTTGCTGGGCGAGTTGCGCGGTCGTGAGGCCTTCGCTTTCCTACGGGCGGTCAATACCGGCCA
TCCCGGCTCCATCACCACGGTCCATGCCGATAGTCCGCAAGGCGCCCTGGATCAGATCGCGCTGCTTTCG
CTGCTCGCGGGCGTGGACCTAGGCTGGGACACAGTTCGCAACTATGTGCGCCAGGTCGTCGATATCGTGG
TGCAACTCAATCGGGTTGGCGGCGGCCGCAAGGTGACGGCGGTGGAGTTTCTGTGTTGA
 Primer design