SecReT4
Protein ID: 222080184
T4SS name [ID]Trb [252]
Gene symboltraG
Locus tagAvi_8128
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]84307..86271 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDB9K3V3
KEGG IDavi:Avi_8128
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.8e-159, Aligned region: 163..634
TraG-D_C [PF12696], Evalue: 8.3e-33, Aligned region: 476..596
TrwB_AAD_bind [PF10412], Evalue: 1.4e-24, Aligned region: 298..609
AAA_10 [PF12846], Evalue: 5.4e-08, Aligned region: 224..555
Protein Sequence: 654 a.a.     [Download]
>gi|222080184|ref|YP_002540047.1| Ti-type conjugative transfer system protein TraG [Agrobacterium vitis S4]
MTASKVFLAVIPAAMMIVVLVFMAGIEHWLAALSKTGQAKLMLGRIGLALPYATAAAIGTLFLFASNGAA
GVKAAGWGVVSGSGVVVAIAVLREGVRLSGITGEVPAGQSVFGYADPATMLGASTTFLAGVFALRVAMKG
NAAFAKAAPRRIGGKRAVHGEADWMKVQEAARLFPDPGGIVVGERYRVDSVAAVSFRADDPLTWGAGGKS
PLLCFDGSFGSSHGIVFAGSGGFKTTSVTVPTALKWGGGLVVLDPSSEVAPMASEHRRKAGRKVIILDPS
ASGVGFNALDWIGRHGSTKEEDIVAVATWIMTDNPRSASARDDFFRASAMQLLTALIADVCLSGHTDEED
QTLRRVRTNLSEPEPQLRARLTKIYEQSESDFVKENVSVFVNMTPETFSGVYANAVKETHWLSYPNYAAL
VSGDSFSTDDLADGGTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGDVKGRALFLLDEVARLGYLR
ILETARDAGRKYGITLTMIFQSIGQMREAYGGRDATSKWFESASWISFAAINDPDTADYISKRCGDTTVE
VDQTNRSSGMKGSSRSRSRQLSRRPLILPHEVLRMRADEQIVFTSGNPPLRCGRAIWFRRKDMSASVGEN
RFHKQIADGVKSYKAAGMTDTEET
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c86271-84307 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGACGGCGAGTAAAGTGTTCCTCGCCGTCATCCCGGCCGCGATGATGATCGTCGTCTTGGTGTTCATGG
CGGGGATCGAACACTGGCTGGCCGCTCTCAGTAAGACCGGGCAGGCAAAGCTGATGCTCGGGCGGATCGG
CCTCGCGCTGCCCTATGCGACCGCGGCTGCGATCGGCACGCTTTTCCTGTTCGCGTCGAATGGCGCAGCG
GGCGTCAAAGCGGCAGGATGGGGTGTTGTCAGCGGAAGTGGAGTGGTAGTCGCGATCGCGGTGCTGCGTG
AAGGGGTTCGCCTTTCCGGGATAACCGGTGAAGTGCCAGCAGGACAGTCCGTGTTTGGATATGCGGACCC
CGCAACGATGCTTGGCGCATCGACAACGTTCCTCGCCGGCGTCTTCGCACTGCGCGTGGCGATGAAGGGT
AACGCAGCTTTTGCCAAAGCCGCACCACGGCGGATTGGGGGAAAGCGAGCGGTGCATGGCGAGGCCGACT
GGATGAAAGTGCAGGAGGCGGCAAGACTTTTCCCCGATCCCGGCGGCATCGTTGTCGGTGAACGGTATCG
TGTCGATAGCGTTGCGGCGGTGTCGTTCCGCGCCGATGATCCGTTGACCTGGGGAGCGGGAGGCAAGAGC
CCGCTCCTATGCTTCGACGGCTCCTTCGGCTCGTCGCATGGCATCGTCTTCGCCGGCTCCGGCGGTTTCA
AGACGACGTCTGTAACGGTCCCGACCGCGCTCAAGTGGGGTGGCGGCCTCGTTGTCCTCGACCCGTCGAG
CGAGGTCGCGCCGATGGCATCGGAGCATCGCCGCAAGGCTGGCAGGAAGGTGATCATTCTCGATCCCTCG
GCGTCAGGCGTCGGCTTCAATGCGCTCGACTGGATCGGGCGACACGGCAGCACGAAGGAAGAGGATATCG
TCGCCGTCGCGACCTGGATTATGACCGACAATCCGCGCTCGGCGTCTGCCCGCGACGACTTCTTTCGGGC
ATCGGCGATGCAGCTTCTGACAGCCCTGATCGCCGACGTCTGCCTATCCGGTCACACGGACGAGGAAGAC
CAGACGCTGCGCCGTGTGCGGACGAACCTTTCGGAGCCTGAACCACAGCTACGGGCGCGCTTGACAAAAA
TCTACGAACAGTCGGAATCGGACTTCGTGAAGGAGAACGTCTCGGTCTTCGTCAACATGACGCCGGAGAC
GTTTTCCGGCGTCTACGCCAATGCGGTGAAAGAAACCCACTGGCTGTCCTATCCGAACTACGCCGCGCTC
GTCTCAGGCGACAGTTTCTCGACCGACGATCTTGCCGATGGCGGGACAGACATCTTTATTGCGCTCGATC
TGAAGGTCCTCGAAGCCCATCCAGGACTGGCGCGTGTGGTTATCGGATCACTGCTCAATGCCATCTACAA
TCGAAATGGCGATGTGAAGGGTCGCGCGCTCTTCCTGCTCGACGAGGTGGCCAGGCTCGGCTACCTGCGG
ATCTTAGAGACCGCGCGCGACGCCGGGCGCAAATACGGCATCACGCTGACGATGATCTTTCAGTCCATCG
GCCAGATGCGCGAGGCCTATGGCGGGCGGGACGCGACGAGCAAATGGTTCGAATCCGCGTCGTGGATCTC
GTTTGCCGCGATCAACGATCCCGACACGGCCGACTATATCTCGAAACGCTGCGGCGATACGACCGTCGAG
GTCGACCAGACAAACCGCTCGTCAGGGATGAAGGGATCGTCGCGCTCACGTTCCCGGCAGCTCAGCCGCC
GTCCACTGATCCTGCCGCATGAGGTGCTGCGCATGCGCGCTGACGAGCAGATCGTGTTCACATCGGGCAA
TCCGCCGCTCCGATGCGGACGCGCCATCTGGTTCCGACGCAAGGATATGAGCGCGTCCGTCGGAGAAAAC
CGCTTTCATAAGCAAATCGCGGACGGAGTGAAGAGCTATAAGGCCGCTGGGATGACAGACACTGAGGAGA
CATGA
 Primer design