SecReT4
Protein ID: 222080188
T4SS name [ID]Trb [252]
Gene symboltraF
Locus tagAvi_8132
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]90329..90859 [+]
Productconjugal transfer pilin processing protease TraF
Component typeTraF
UniProt IDB9K3V7
KEGG IDavi:Avi_8132
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.6e-44, Aligned region: 29..173
Protein Sequence: 176 a.a.     [Download]
>gi|222080188|ref|YP_002540051.1| conjugative transfer signal peptidase TraF [Agrobacterium vitis S4]
MRRRRVLLLLTGAGVLMSGLVSIAFLGGYRLNLTTSEPLGLWRIDALHRPVAIGDLVFICPPETSAIEQA
RVRGYLRRGLCDDGFAPLIKTIAALPGQHVDIAGHVAIDGRSLPASTVRDRDGEGRPLTPDPGGIVPPHH
LFLHSSFASSYDSRYFGPVPDSGLLGLAQPVITFDP
 
Nucleotide Sequence: 531 bp     [Download]
>gi|222080117|ref|NC_011982.1|:90329-90859 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGAGGCGGCGTAGGGTTCTGTTGTTGCTGACGGGCGCCGGCGTCCTTATGTCAGGTCTGGTGTCGATAG
CGTTCTTGGGCGGGTATCGGCTGAATCTGACGACGAGCGAGCCGCTCGGGCTTTGGCGCATCGATGCGCT
TCACCGTCCGGTCGCGATCGGCGATCTTGTTTTCATTTGCCCGCCGGAAACATCGGCAATCGAGCAAGCC
CGCGTGCGCGGGTATTTGCGGCGTGGGCTCTGCGATGACGGGTTTGCGCCGTTGATCAAGACGATCGCGG
CGCTGCCCGGTCAGCATGTCGACATCGCCGGCCACGTTGCCATCGATGGCCGCTCTTTACCTGCATCCAC
TGTGCGCGATCGGGACGGTGAGGGCAGACCGCTCACCCCTGATCCCGGCGGCATCGTGCCGCCGCATCAC
CTGTTTCTCCACTCTTCCTTTGCGAGCTCCTATGATAGTCGATACTTCGGCCCGGTTCCGGATTCCGGTC
TTCTCGGCTTGGCGCAGCCGGTTATCACCTTCGATCCGTGA
 Primer design