SecReT4
Protein ID: 222080232
T4SS name [ID]VirB [14]
Gene symbolvirD4
Locus tagAvi_8210
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]150781..152772 [-]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDB9K401
KEGG IDavi:Avi_8210
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-156, Aligned region: 98..542
TraG-D_C [PF12696], Evalue: 1.4e-27, Aligned region: 392..510
TrwB_AAD_bind [PF10412], Evalue: 2.6e-24, Aligned region: 139..523
AAA_10 [PF12846], Evalue: 1.1e-07, Aligned region: 141..468
Protein Sequence: 663 a.a.     [Download]
>gi|222080232|ref|YP_002540095.1| virA/G regulated protein [Agrobacterium vitis S4]
MMNSGKYTPIGLAAIIACSLAVGFCAASLYVTFRHGFTGEKMMTFSVFTFLYETPPYLGYASPTFYRGLA
IIVVTSTVVLLGQLLLSMRDRQHHGTARWAGSSEMRHAKYLQRYSHVTGPIFGKTCGPRWFGSYLSNGEQ
PHSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFELTSRARRSSGDAVFKFSPLDPERRTHCYNP
VLDIAALPAERRFTETRRLAANLITAKGKGAEGFIDGARDLFVAGILSCIERGTPTIGAVYDLFAQPGEK
YKLFAQLAEETQNKEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKKT
CIYLCVSPNDLEVVAPLMRLLFQQVVSILQRSLPLGDERHDVLFLLDEFKHLGKLEAVETAITTIAGYKG
RFMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFQARSTSYSQARMFDHN
IQISEQGAPLLRAEQVRLLDDDHEIVLIKGQPPLKLRKVRYYSDLILKRLFESQQGSLPEPASLRLPEDT
NIFEGKLDQKAVDPISQKPVQIEESDYGKVVTPVSRPVAEGEHSAVIEVRTGSNEVDDKHEYRGADAATS
EELLDIAPALLAQRELLEQIISLQQRGGTDSGT
 
Nucleotide Sequence: 1992 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c152772-150781 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
GTGATGAATTCAGGCAAGTACACGCCAATAGGCCTAGCTGCGATCATTGCATGTTCACTGGCCGTTGGTT
TTTGTGCAGCAAGTCTCTATGTCACATTTCGCCATGGATTTACGGGCGAAAAGATGATGACTTTCAGCGT
TTTTACGTTCCTGTACGAGACACCACCTTACTTGGGGTACGCAAGCCCTACGTTCTACCGCGGACTTGCC
ATCATCGTGGTGACGTCGACAGTTGTGTTGCTAGGCCAACTGTTGTTATCGATGCGCGATCGCCAACATC
ACGGCACCGCTCGCTGGGCCGGTTCAAGCGAGATGCGGCACGCCAAATACCTCCAGCGCTACAGTCACGT
CACGGGTCCCATATTCGGCAAAACATGCGGACCGCGCTGGTTCGGTAGCTACCTGAGTAATGGAGAACAA
CCTCACAGTCTTGTTGTTGCCCCAACCCGCGCTGGTAAGGGCGTAGGCGTCGTTATCCCGACGTTGCTAA
CCTTTAAGGGCTCAGTAATCGCTTTGGATGTGAAAGGCGAGCTATTTGAACTCACATCGAGGGCGCGCAG
ATCAAGCGGCGACGCCGTTTTCAAGTTCTCGCCCCTAGATCCAGAGCGGCGAACCCACTGTTACAACCCC
GTGCTTGATATTGCCGCGTTGCCGGCCGAACGGCGCTTTACAGAAACGCGTCGCCTTGCTGCGAATCTCA
TCACAGCCAAAGGAAAGGGAGCGGAGGGTTTCATCGACGGCGCACGGGATCTTTTCGTAGCAGGCATATT
GAGTTGTATTGAGCGCGGCACACCAACGATCGGCGCGGTTTACGACCTGTTCGCTCAGCCGGGCGAAAAA
TACAAGCTATTTGCGCAACTGGCGGAGGAAACACAAAACAAAGAGGCTCAGCGAATCTTCGACAATATGG
CCGGAAATGACACCAAAATACTGACGTCCTACACATCGGTGCTCGGCGACGGCGGCCTCAATCTTTGGGC
CGATCCACTCGTTAAGGCGGCTACAAGCCGCTCGGATTTTTCCGTCTACGATTTGCGGCGGAAAAAGACT
TGCATTTATCTTTGTGTCAGCCCGAATGATCTCGAAGTCGTAGCGCCGTTGATGCGTCTTCTCTTCCAGC
AGGTTGTATCAATCCTGCAGCGATCGCTGCCCCTTGGGGATGAACGGCACGATGTTCTATTTCTCCTCGA
TGAGTTCAAGCACCTGGGCAAGCTGGAAGCCGTAGAGACGGCGATTACTACGATCGCCGGCTACAAGGGC
CGCTTCATGTTCATCATACAGAGCCTGTCGGCTTTGACCGGAACCTATGATGAAGCTGGTAAGCAAAATT
TCCTCAGCAATACTGGTGTGCAGGTATTCATGGCGACCGCTGATGACGAGACGCCAACCTACATTTCTAA
AGCTATCGGCGACTACACGTTCCAAGCTCGCTCGACTTCGTACAGCCAAGCGCGCATGTTTGATCACAAC
ATCCAAATCTCCGAACAAGGAGCGCCGCTTCTGCGTGCCGAACAGGTCCGCCTACTCGACGATGACCATG
AAATAGTCCTTATCAAGGGCCAACCTCCCCTTAAACTGCGAAAAGTGCGATATTATTCGGATCTCATATT
GAAGCGGCTCTTCGAAAGCCAACAGGGTTCCCTTCCCGAGCCCGCATCTTTGAGGCTGCCGGAAGATACG
AACATCTTCGAAGGCAAGCTTGACCAGAAAGCAGTCGATCCAATATCGCAAAAACCGGTGCAGATTGAAG
AGAGCGACTACGGGAAAGTCGTTACCCCCGTAAGCAGACCTGTGGCCGAGGGAGAGCACAGCGCGGTGAT
AGAAGTTCGCACCGGTTCAAACGAAGTTGATGACAAACATGAATACAGGGGCGCGGACGCCGCAACCTCC
GAGGAGCTTCTGGACATTGCTCCAGCTCTTCTGGCGCAACGCGAACTCCTTGAACAGATCATTTCTCTCC
AGCAACGAGGTGGAACAGATTCCGGCACTTGA
 Primer design