SecReT4
Protein ID: 222080239
T4SS name [ID]VirB [14]
Gene symbolvirB11
Locus tagAvi_8218
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]159841..160875 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDB9K408
KEGG IDavi:Avi_8218
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-58, Aligned region: 13..310
Protein Sequence: 344 a.a.     [Download]
>gi|222080239|ref|YP_002540102.1| P-type DNA transfer ATPase VirB11 [Agrobacterium vitis S4]
MEVNPQLRVLLKPVLQWLDDPRTEEVAINGPGEAFVRQSGVFTRFAAPFSCDDLEDIAILAGALRKQDVG
PRNPLCATELPGGERMQICLPPTVPSGTVSLTIRRPSNRVSELGEVSARYDARRWNQWQIRTQRRDQLDE
AILRDYDNGDLESFLRACVIGKRTMLLCGPTGSGKTTMSKTLISAIPREERLITIEDTLELVIPHENHVR
LLYSKSGGGLGAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKL
FSLVKSSAQGASLEDRTLIDMLATAIDVIVPFRAYGDVYEVGEVWLAADARRRGETIGDLLNQH
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c160875-159841 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGGAAGTAAATCCGCAATTGCGCGTCCTTCTTAAACCAGTCTTGCAATGGCTCGATGACCCGAGAACTG
AAGAAGTCGCCATAAACGGACCGGGAGAAGCCTTTGTACGCCAAAGTGGCGTCTTCACGAGGTTCGCTGC
ACCGTTCTCTTGTGATGACCTTGAAGACATCGCCATTCTAGCAGGGGCGTTGCGAAAACAAGATGTCGGC
CCCCGGAACCCTCTTTGCGCCACCGAACTCCCTGGCGGCGAGCGGATGCAAATCTGCTTGCCGCCAACTG
TACCCTCTGGCACCGTTAGCTTGACAATTCGACGGCCGAGCAATCGTGTCTCGGAATTGGGAGAAGTCTC
CGCTCGCTACGATGCCCGTCGATGGAATCAGTGGCAAATCAGGACGCAGCGACGAGATCAACTAGACGAA
GCGATCCTGCGCGACTACGACAACGGCGATCTAGAATCATTTTTACGTGCATGTGTTATCGGTAAGCGGA
CGATGTTGCTTTGTGGTCCGACCGGTAGTGGCAAAACCACGATGAGCAAGACCTTGATCAGCGCTATTCC
ACGGGAGGAAAGGCTGATAACCATTGAAGATACGCTCGAACTGGTCATTCCACACGAGAATCATGTCAGA
CTGCTGTACTCCAAGAGTGGGGGCGGGCTAGGTGCGGTAACGGCGGAACAATTGCTTCAGGCAAGCCTTA
GGATGCGTCCTGACCGAATATTACTCGGTGAGATGCGCGACGACGCTGCGTGGGCTTACCTGAGTGAGGT
TGTCTCAGGTCATCCTGGATCAATTTCAACGATACATGGTGCGAACCCCGTCCAAGGCTTCAAGAAGCTG
TTCTCACTTGTGAAGAGCAGTGCCCAAGGTGCGAGTTTGGAAGATCGCACATTGATTGATATGTTAGCCA
CGGCTATCGATGTGATTGTTCCCTTTCGTGCGTATGGCGATGTTTACGAAGTGGGCGAGGTTTGGCTCGC
CGCCGATGCCCGCCGGCGCGGTGAAACGATAGGGGATCTTCTAAACCAGCACTAG
 Primer design