SecReT4
Protein ID: 222080242
T4SS name [ID]VirB [14]
Gene symbolvirB8
Locus tagAvi_8221
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]162905..163618 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDB9K411
KEGG IDavi:Avi_8221
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5e-42, Aligned region: 23..227
Protein Sequence: 237 a.a.     [Download]
>gi|222080242|ref|YP_002540105.1| component of type IV secretion system [Agrobacterium vitis S4]
MIDSEYALLVEREALADHYKEVEAFQSARARSARRISRALAALAIIAVAGNLAQAFAIAVMVPLNKLVPV
YLWVRPDGTVDSEVSVSRLPATQEQAVVNASLWEYVRLRESYTSDTAQYAYDLVSSFSAPTVRQDYQQFF
NYPSPSSPQTIIGKRGKLESEHISSNELMPGVQQIRYKRTLTMEGQAPIVTTWTATVHYETVANLPGRLR
LTNPGGLIVTSYQTSEDSVSNTTRSQQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c163618-162905 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGATCGACTCTGAATACGCGCTATTGGTAGAGCGGGAAGCATTGGCGGACCACTATAAGGAAGTAGAAG
CATTTCAGTCCGCACGTGCTCGATCAGCTCGGCGAATCTCCAGAGCCTTGGCTGCTTTGGCAATCATTGC
AGTCGCAGGAAACCTGGCGCAGGCCTTCGCCATCGCCGTTATGGTTCCGTTGAACAAACTTGTGCCCGTA
TATCTGTGGGTGCGCCCGGACGGTACAGTTGACAGTGAAGTATCTGTTTCGCGGTTGCCGGCCACGCAGG
AGCAGGCGGTCGTGAATGCGTCTCTATGGGAGTATGTCCGTCTGCGTGAGAGCTACACATCGGATACAGC
TCAATACGCCTATGATCTGGTCTCGAGCTTTAGTGCCCCAACGGTGCGCCAAGATTATCAGCAGTTCTTC
AATTATCCCAGTCCTAGCTCCCCCCAAACCATCATTGGTAAGCGCGGAAAACTGGAATCTGAGCACATCT
CTTCAAACGAACTTATGCCCGGCGTTCAGCAGATCCGCTACAAACGCACTCTCACCATGGAAGGGCAAGC
TCCAATAGTAACGACATGGACCGCAACGGTACACTATGAAACGGTAGCTAACTTGCCAGGCCGACTGAGG
CTGACAAATCCGGGCGGTTTAATCGTTACCTCCTATCAAACTTCGGAAGATTCCGTTTCGAACACGACGC
GGAGCCAGCAATGA
 Primer design