SecReT4
Protein ID: 222080310
T4SS name [ID]Trb [252]
Gene symboltrbI
Locus tagAvi_8323
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]248211..249524 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDB9K480
KEGG IDavi:Avi_8323
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.9e-63, Aligned region: 249..432
Protein Sequence: 437 a.a.     [Download]
>gi|222080310|ref|YP_002540174.1| conjugal transfer protein [Agrobacterium vitis S4]
MVQSLKLGGAQNSQAASGIRRINRLPIVVVIVLAVAFLGIIFYGLASRGLYFGRDKGPETSSGDPASTFA
DQIKRGVTDGIIGEPQQQTTFQPTPVETKQVEEKAANPFTQQPAQRQEQRRGQELEPEEVWRARLAREQQ
EQILREQQRQRMARMQARDTAYDAPLAIDRGKLEARSTTDDATAGRTSTATATTSANPSDLYSAALRAGL
DGQNVDPNGQRPKEDFFNADLKDLGYLSNRVVPQQSAFELKRGSVIPATLTTGINSDLPGRITAQVSQNV
YDSATGHRLLIPQGTKLFGRYDSKVSFGQSRVLVVWSDIIFPNGSTLQIGGMAGTDAEGYGGFRDKVNNH
YLKTFGSAVLIALIGTGIDMAVPESSTLATQDTASDAARRNFAETFGRVADRTIQRNMDVQPTLEIRPGY
KFNVLVDQDIIFPGSYR
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c249524-248211 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGGTACAATCCCTCAAACTCGGCGGCGCGCAAAACAGTCAAGCGGCATCGGGGATCCGGCGGATCAATC
GCCTGCCGATCGTCGTCGTTATCGTGCTGGCAGTCGCCTTCCTTGGCATCATCTTCTATGGGCTTGCCTC
GCGTGGGCTTTATTTCGGGAGGGATAAAGGCCCGGAGACCAGTTCCGGCGATCCTGCCTCAACTTTTGCC
GATCAGATCAAGCGCGGTGTCACCGACGGTATTATCGGCGAACCGCAGCAGCAGACAACGTTTCAGCCGA
CTCCGGTCGAAACAAAACAGGTTGAGGAGAAAGCGGCCAACCCCTTCACTCAGCAACCGGCACAGAGACA
GGAGCAACGGCGCGGGCAGGAACTGGAACCGGAGGAGGTCTGGCGGGCACGGCTTGCCCGTGAACAACAA
GAGCAGATTCTCCGCGAGCAACAGCGCCAGCGGATGGCCCGGATGCAGGCCCGGGACACGGCATATGACG
CCCCGCTTGCCATCGACCGCGGCAAACTGGAAGCGCGATCAACAACAGATGACGCGACTGCGGGCAGAAC
ATCCACTGCAACGGCAACAACCTCGGCAAACCCTTCGGACCTCTATTCGGCCGCGCTGCGCGCTGGCCTT
GACGGCCAAAACGTCGATCCGAATGGACAGCGACCCAAGGAAGACTTTTTCAATGCCGATCTCAAGGATC
TCGGTTACCTGTCGAACCGCGTCGTGCCACAGCAATCGGCATTCGAATTGAAGCGCGGCTCCGTCATTCC
TGCGACACTCACTACAGGGATCAATTCCGATCTTCCCGGACGCATCACCGCCCAGGTGAGCCAGAACGTC
TATGACAGCGCGACCGGACATCGCCTGCTGATCCCGCAAGGGACGAAACTGTTCGGCCGTTACGACAGCA
AGGTATCGTTCGGCCAGAGCCGCGTGCTCGTCGTCTGGTCCGACATCATCTTCCCGAACGGCTCGACACT
GCAGATCGGTGGCATGGCCGGGACGGATGCCGAAGGTTATGGCGGGTTCAGGGACAAGGTGAACAACCAC
TACCTTAAAACATTTGGCTCGGCTGTACTGATTGCCCTGATCGGGACCGGCATCGATATGGCAGTACCGG
AGAGTTCGACGCTAGCAACACAGGACACGGCCTCGGATGCAGCCCGGCGGAATTTTGCCGAGACCTTTGG
GAGAGTCGCCGACCGGACGATTCAGCGCAACATGGACGTGCAGCCAACGCTCGAAATTCGGCCCGGCTAC
AAGTTCAATGTGCTCGTCGATCAGGACATAATCTTCCCGGGCAGCTATCGATGA
 Primer design