SecReT4
Protein ID: 222080311
T4SS name [ID]Trb [252]
Gene symboltrbH
Locus tagAvi_8324
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]249537..250013 [-]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDB9K481
KEGG IDavi:Avi_8324
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 3e-26, Aligned region: 49..154
Protein Sequence: 158 a.a.     [Download]
>gi|222080311|ref|YP_002540175.1| conjugal transfer protein [Agrobacterium vitis S4]
MKILAFIRRPLNLIPSLAAACILAILHSGCQSIDTEGLVASNAPPELSGPAASAIAGDMVSRLAEQIGPD
KATVALKVDTSPFGQAMEAALKGWGYAVVTDQKTDSGTTVVPLAYAIISFDGQVLARLSTNSVELGRAYT
VTSTGATPTSALALMRRG
 
Nucleotide Sequence: 477 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c250013-249537 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGAAGATTCTTGCCTTCATTCGACGCCCCCTGAACCTTATACCTAGCCTTGCTGCCGCCTGCATCCTCG
CCATCCTCCATTCCGGGTGCCAATCGATCGACACAGAAGGTCTTGTCGCCAGCAACGCGCCGCCCGAACT
CTCAGGACCAGCGGCGAGCGCCATTGCCGGTGACATGGTCAGCCGCCTTGCCGAACAGATCGGGCCGGAC
AAGGCAACCGTTGCACTAAAGGTCGATACTTCACCCTTCGGTCAGGCAATGGAGGCGGCGCTGAAGGGAT
GGGGTTATGCGGTCGTCACCGACCAGAAGACGGATAGCGGAACGACCGTCGTCCCACTTGCCTATGCGAT
CATATCATTCGACGGGCAGGTGCTGGCGCGCCTTTCGACCAACAGCGTCGAACTCGGCCGCGCTTACACG
GTGACTTCGACCGGTGCCACGCCGACGAGCGCGCTTGCGCTGATGCGGCGCGGGTGA
 Primer design