SecReT4
Protein ID: 222080312
T4SS name [ID]Trb [252]
Gene symboltrbG
Locus tagAvi_8325
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]250013..250867 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB9K482
KEGG IDavi:Avi_8325
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-58, Aligned region: 68..281
Protein Sequence: 284 a.a.     [Download]
>gi|222080312|ref|YP_002540176.1| P-type conjugative transfer protein TrbG [Agrobacterium vitis S4]
MNIRHRRQRATLAIGLLVFAIVPLTVLDPRTVLAADGVTANEAKGMGLSTQWRGSKGLVTKGADGKVIFL
YGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPGLVTSMVVT
TSRRTYHIQLKSHPTQYMARVGFEYPEDVSTKLADVNARLEASTIPGAGVPAEQLSFSYSISGSAGWRPT
RVYSDGLKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKSNMMVADYNIDRAVLVSGVGWKQQKVTIT
RGGR
 
Nucleotide Sequence: 855 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c250867-250013 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGAATATCAGACACAGAAGACAACGGGCTACGCTGGCCATCGGCCTCTTGGTTTTTGCGATCGTCCCCT
TGACCGTCCTCGACCCCCGGACTGTGCTTGCCGCTGATGGTGTCACCGCCAACGAGGCGAAAGGCATGGG
GCTCTCGACCCAATGGCGCGGGTCGAAAGGCCTGGTCACCAAGGGCGCGGACGGTAAGGTGATCTTTCTC
TATGGCGAGGTTCAGCCATCGGTCGTCTGCTCACCGCTGCAGGTCTGCGATATCGAACTTCAGGGCGGCG
AGGTAGTGCGCGATGTGCTGGTCGGCGATACGGTCCGCTGGAAAGTGGAGCCGGCGACATCGGGCGCGGC
CGGGGGCCAGGCCATCCATCTTATCGTCAAGCCATCCGAACCGGGACTTGTCACCTCGATGGTGGTGACC
ACATCCCGGCGGACATATCATATCCAGCTCAAGTCGCATCCCACGCAATATATGGCCCGCGTCGGCTTCG
AATACCCCGAGGATGTTTCCACGAAACTCGCCGACGTCAACGCGCGGCTTGAAGCCAGTACGATCCCCGG
CGCCGGGGTGCCGGCGGAGCAGCTGAGCTTTTCCTATTCCATATCAGGCAGCGCCGGTTGGCGGCCGACA
CGGGTCTATTCCGATGGCCTGAAAACCTACATCCAGTTCCCGCGGTCGATCTCGGGTCAGGATGCGCCGG
TTCTCTTCGTCGTCTCCGGTGGCCAGAACCGTATCGTCAACTACCGCATGAAGAGCAATATGATGGTGGC
CGATTACAACATCGATCGCGCTGTGCTCGTCTCAGGCGTCGGCTGGAAACAACAAAAGGTAACGATCACC
AGGGGAGGGCGGTGA
 Primer design