SecReT4
Protein ID: 222080313
T4SS name [ID]Trb [252]
Gene symboltrbF
Locus tagAvi_8326
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]250884..251546 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB9K483
KEGG IDavi:Avi_8326
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.7e-43, Aligned region: 13..218
Protein Sequence: 220 a.a.     [Download]
>gi|222080313|ref|YP_002540177.1| conjugal transfer protein [Agrobacterium vitis S4]
MAGPTPPDNPYIAARNEWNERYGSYVKAAAAWRIVGITGMTMAVIGFGYALYQSTQVKLIPYIVEVDKLG
TAVNAGFPQQIEYADPRVVRATLGSFVSNFRSVTPDAVVQKQYIDRTYGLLRTSDPATEKVNAWFRSNSP
FEKAKTATVAIEVNNIVALSNQSYQVDWTEFERDRRGKETATRRFRGIATVTLTPPQDEGVIRLNPIGLY
LRDFDWTAQL
 
Nucleotide Sequence: 663 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c251546-250884 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGGCTGGACCCACTCCACCAGACAACCCCTATATCGCTGCGCGCAACGAATGGAACGAACGCTACGGCT
CATACGTGAAAGCGGCCGCCGCCTGGCGCATTGTCGGCATCACCGGCATGACAATGGCGGTGATCGGTTT
CGGCTATGCGCTCTACCAGAGCACGCAGGTGAAGCTGATCCCCTATATCGTCGAGGTCGACAAGCTCGGC
ACGGCCGTCAATGCCGGCTTTCCGCAGCAGATCGAATATGCCGATCCGCGCGTGGTGCGTGCTACGCTCG
GCAGTTTCGTCTCGAACTTCCGCTCCGTCACGCCCGACGCCGTCGTCCAGAAACAATACATCGACCGGAC
CTACGGGCTGCTGCGGACATCCGATCCGGCGACCGAAAAGGTCAATGCCTGGTTTCGCTCGAATTCGCCG
TTCGAAAAGGCGAAGACAGCGACCGTGGCCATCGAGGTCAACAACATCGTCGCGCTATCGAACCAGAGTT
ATCAGGTCGACTGGACCGAATTCGAGCGCGATCGGCGAGGCAAGGAAACGGCGACACGCCGCTTCCGCGG
CATTGCCACTGTGACGCTGACGCCACCCCAGGACGAAGGCGTCATCCGTCTTAATCCAATCGGTCTCTAT
CTCCGCGACTTCGACTGGACTGCACAGCTTTGA
 Primer design