SecReT4
Protein ID: 222080314
T4SS name [ID]Trb [252]
Gene symboltrbL
Locus tagAvi_8328
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]251561..252589 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB9K484
KEGG IDavi:Avi_8328
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.3e-31, Aligned region: 14..225
Protein Sequence: 342 a.a.     [Download]
>gi|222080314|ref|YP_002540178.1| P-type conjugative transfer protein TrbL [Agrobacterium vitis S4]
MNAARSLFWILAGIEVGIAAVWLAINAASLDSWFAELVKRIMFIGLFAFILDRGPEFAKAVVDSLYQIGA
GGGSASPANIFDAGIRVATKMSEQAKFGLWEDNALAIAAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLA
GMIMLGLGGSSHTKDFAVKYLVYAFSVGMKLMALVMIAKIGSDILLGLAEAPTATSEQFITTLAIAGISV
VVFVIAMYVPPILQGVVQGASVGGGMEAIRHGGQAASAALGAGFLTIGAANRGFEAAGAARAGGASLAGA
AMRGLEAGVGGAAGAVGSAAKDKAIGSPGAYAGSMLGLANAKLDQQSGRAGTKPPPPINDKK
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c252589-251561 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGAACGCCGCGCGATCGTTGTTCTGGATCCTCGCCGGCATCGAGGTCGGAATCGCCGCCGTGTGGCTGG
CGATCAACGCCGCCTCGCTCGACAGCTGGTTCGCCGAACTTGTCAAACGCATCATGTTCATCGGCCTGTT
CGCCTTCATCCTCGACAGGGGCCCGGAGTTCGCCAAGGCCGTGGTCGACAGCCTCTATCAGATCGGTGCG
GGCGGCGGTTCGGCCTCGCCTGCCAATATCTTTGACGCTGGTATTCGCGTTGCGACTAAAATGTCTGAAC
AGGCCAAGTTCGGACTGTGGGAAGACAATGCGCTGGCCATCGCTGCCGTCTTCGCCATGGTCGTGGTCGT
CGTATCATTCTCGCTGGTGGCCGCAATCTTCGTGGCCGTGATGGTCGAGATGTATGTCGGCCTGCTCGCC
GGCATGATCATGCTCGGGCTCGGCGGCTCCTCTCATACCAAGGACTTTGCCGTCAAATATCTGGTTTACG
CCTTCTCCGTCGGCATGAAGCTGATGGCGCTGGTGATGATCGCCAAAATCGGCTCCGACATCCTGCTCGG
CCTTGCCGAAGCGCCGACGGCGACATCTGAACAGTTCATCACCACCTTGGCGATCGCCGGCATCTCGGTC
GTGGTCTTCGTCATCGCCATGTATGTACCGCCGATACTGCAGGGTGTGGTCCAGGGCGCATCGGTCGGCG
GTGGCATGGAGGCCATCCGCCACGGAGGACAGGCAGCCTCCGCTGCCCTTGGTGCCGGCTTCCTCACGAT
CGGTGCTGCAAATCGGGGCTTTGAGGCAGCAGGTGCCGCGAGGGCAGGGGGAGCGTCATTGGCAGGTGCC
GCCATGCGCGGGTTGGAAGCCGGCGTTGGCGGAGCGGCCGGCGCAGTTGGCTCGGCTGCCAAGGACAAGG
CTATCGGCTCGCCCGGTGCCTATGCCGGTTCGATGCTCGGCCTCGCCAACGCCAAGCTCGACCAGCAATC
CGGCCGGGCCGGTACAAAGCCGCCACCGCCGATCAATGACAAGAAGTAA
 Primer design