SecReT4
Protein ID: 222080315
T4SS name [ID]Trb [252]
Gene symboltrbK
Locus tagAvi_8329
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]252739..252966 [-]
Productentry-exclusion protein
Component typeTrbK
UniProt IDB9K485
KEGG IDavi:Avi_8329
PDB IDNA
Domain hit(s) vs Pfam DUF2749 [PF10907], Evalue: 3.6e-29, Aligned region: 4..75
Protein Sequence: 75 a.a.     [Download]
>gi|222080315|ref|YP_002540179.1| entry-exclusion protein [Agrobacterium vitis S4]
MSSRLIVILALLAVVAAASAGIGTWITVQPEPASGSGAAATDTPSSEEQRRRRDQFFGGDSNRDIRGGQE
MKPRW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c252966-252739 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
GTGAGCTCGCGTCTGATCGTCATTCTCGCGCTCTTGGCCGTCGTCGCCGCAGCAAGTGCAGGCATCGGCA
CCTGGATTACTGTCCAGCCGGAGCCGGCCTCCGGATCTGGCGCGGCCGCGACCGATACTCCTTCGAGTGA
AGAACAGCGCCGGCGTCGTGATCAGTTCTTCGGCGGGGATTCAAATCGTGACATCCGCGGCGGCCAGGAG
ATGAAACCGAGATGGTAG
 Primer design