SecReT4
Protein ID: 222080316
T4SS name [ID]Trb [252]
Gene symboltrbJ
Locus tagAvi_8330
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]252963..253772 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB9K486
KEGG IDavi:Avi_8330
PDB IDNA
Domain hit(s) vs Pfam DUF2749 [PF10907], Evalue: 4.5e-06, Aligned region: 245..269
Protein Sequence: 269 a.a.     [Download]
>gi|222080316|ref|YP_002540180.1| P-type conjugative transfer protein TrbJ [Agrobacterium vitis S4]
MPKRSFKLNKVVCVAIGAAGILPIVLPASALAGGVTGQATEWTQLANNTELISLVGKSAEQVNNQITQIN
QLAEQIQNQLNIYRNMLQNTAQLPDHIWGQVENDLKNLQNVVNEGQGIAFSMGNVEDVMKQRFQSFAETK
SNLPDGASFSTTYQNWSDTNRDTIAGTLKAANLTSEQFSSEESTMSSLRSISESSDGQMKALQVGHQIAA
QQVAQMQKLRGLVSQQMTMMGTWYQSEQAQKDLAQARREQFFSGTEHDIRGGQTMEPRW
 
Nucleotide Sequence: 810 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c253772-252963 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGCCGAAACGCTCTTTCAAACTGAATAAGGTTGTCTGCGTAGCTATTGGCGCCGCCGGCATCTTACCGA
TCGTCCTGCCCGCCTCGGCGCTCGCCGGCGGCGTGACGGGGCAGGCGACGGAATGGACGCAGCTTGCCAA
CAACACCGAGCTGATAAGCCTCGTCGGCAAGTCGGCCGAACAGGTCAACAACCAGATCACCCAGATCAAT
CAGCTGGCCGAGCAGATCCAGAACCAGCTCAATATCTACAGGAACATGCTTCAAAACACTGCGCAGCTGC
CGGACCATATCTGGGGGCAGGTCGAGAACGACCTCAAAAACCTGCAGAACGTCGTCAACGAGGGGCAGGG
CATCGCCTTCTCAATGGGCAATGTCGAAGATGTCATGAAGCAGCGTTTCCAGAGTTTTGCCGAGACGAAG
AGCAATCTGCCTGATGGTGCGAGCTTTTCCACGACCTACCAGAACTGGTCCGACACCAACCGCGATACGA
TCGCCGGCACACTGAAGGCCGCGAACCTGACGTCGGAACAATTCTCCAGCGAAGAAAGCACCATGTCGTC
GTTGCGCTCCATATCGGAATCATCCGACGGCCAGATGAAGGCCCTGCAGGTCGGGCATCAGATCGCCGCC
CAGCAGGTGGCGCAGATGCAGAAGCTGCGCGGTCTCGTCTCGCAACAGATGACGATGATGGGCACCTGGT
ATCAGTCGGAGCAGGCACAGAAGGATCTGGCTCAAGCGAGGCGTGAACAGTTCTTCAGCGGGACCGAACA
CGACATCCGCGGCGGCCAGACGATGGAGCCACGCTGGTGA
 Primer design