SecReT4
Protein ID: 222080317
T4SS name [ID]Trb [252]
Gene symboltrbE
Locus tagAvi_8331
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]253744..256206 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDB9K487
KEGG IDavi:Avi_8331
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.5e-55, Aligned region: 186..400
AAA_10 [PF12846], Evalue: 1.6e-32, Aligned region: 457..731
Protein Sequence: 820 a.a.     [Download]
>gi|222080317|ref|YP_002540181.1| conjugal transfer protein [Agrobacterium vitis S4]
MVALKSFRHSGPSFADLVPYAGLVDNGVILLKDGSLMAGWYFAGPDSESSTDAERNDVSRQINAILSRLG
SGWMIQVEAVRVPTADYPQQPDCHFPDLVTRAIDAERRAHFQKERGHFESRHALILTWRPPEPRRSGLTR
YIYSDTASRSATHADKALDSFLSSIREVEQYLANVVSIRRMMTRETSERGGFRVARYDELFQFIRFCVAG
ENHPVRLPDIPMYLDWLVTAELQHGLTPLIENRFLGVVAIDGLAAESWPGILSALDLMPLTYRWSSRLIF
LDAEEARAKLERTRKKWQQKVRPFFDQLFQTQSRSLDQDAMMMVAETEDAIAEASSQLVAYGYYTPVIVL
FEEDQTQLQEKCEAIRRLIQAEGFGARIETLNATDAFLGSLPGVSYANIREPLINTRNLADLIPLNSVWS
GSAVAPCPFYPPASPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLSLIAAQFRRYAGAQIFA
FDKGGSMLPLTLGLDGDHYQIGGDATGGGEGKALSFCPLADLTTDGDHAFAAEWIEMLVALQGVTITPDY
RNAISRQVGLMAESRGRSLSDFVSGVQMREIKDALHHYTVDGPMGQLLDAEEDGLALGSFQCFEIEELMN
MGERNLVPVLTYLFRRIEKRLTGAPSLIILDEAWLMLGHPVFRDKIREWLKVLRKANCAVVLATQSISDA
ERSGIIDVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVATAIPKRDYYVVSPEGRRLFDMAL
GPIALSFVGASGKEDLKSIRALHSEHGASWPLQWLQQRGIAHAETLFQTE
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c256206-253744 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGGTCGCCCTCAAATCCTTCCGTCATTCCGGGCCATCCTTCGCCGATCTGGTGCCTTACGCCGGTCTGG
TCGACAACGGCGTCATCCTGCTGAAGGACGGCTCGCTGATGGCCGGCTGGTACTTTGCCGGCCCTGACAG
TGAGAGTTCGACGGACGCCGAACGCAATGACGTCTCTCGGCAGATCAATGCGATCCTGTCGCGGCTCGGC
TCCGGCTGGATGATCCAGGTCGAAGCCGTCAGGGTGCCGACTGCGGATTACCCGCAACAGCCCGACTGCC
ATTTTCCTGATCTTGTCACCCGCGCGATCGATGCGGAGCGACGTGCACATTTCCAGAAGGAAAGAGGGCA
TTTCGAGAGCCGGCATGCGCTGATCCTGACCTGGCGGCCGCCGGAGCCGCGGCGCTCCGGCCTGACCCGC
TATATCTATTCGGACACCGCCAGCCGGTCCGCAACTCACGCCGACAAGGCGCTGGACAGCTTTCTCTCCT
CGATCCGGGAGGTCGAGCAGTATCTAGCCAATGTCGTGTCGATCCGCCGGATGATGACGCGCGAAACGTC
GGAGCGCGGCGGCTTTCGTGTTGCCCGCTATGACGAGCTTTTCCAGTTCATCCGCTTCTGCGTGGCCGGC
GAGAACCATCCGGTGCGCCTGCCGGATATCCCCATGTATCTTGACTGGCTGGTGACGGCGGAACTCCAGC
ACGGGCTGACGCCGCTCATCGAGAATCGCTTTCTCGGCGTCGTCGCGATCGACGGCTTGGCCGCAGAAAG
CTGGCCCGGCATCCTCAGCGCGCTCGATCTGATGCCGCTGACCTATCGTTGGTCGTCGCGTCTTATCTTC
CTGGACGCGGAGGAAGCGCGGGCAAAACTCGAGCGCACCCGCAAGAAGTGGCAGCAGAAGGTCCGGCCTT
TTTTCGACCAGCTATTCCAGACCCAATCGCGATCGCTTGATCAGGACGCCATGATGATGGTGGCGGAAAC
CGAGGATGCGATTGCCGAGGCGTCGTCGCAACTCGTAGCGTATGGCTATTACACGCCGGTTATCGTCCTG
TTCGAAGAAGACCAGACTCAGCTTCAGGAAAAGTGCGAGGCGATCCGCCGTCTCATCCAGGCCGAAGGGT
TTGGTGCCCGGATCGAGACGTTGAATGCGACCGATGCCTTTCTCGGCAGCCTGCCCGGCGTCTCCTACGC
CAATATCCGCGAGCCGCTGATCAATACGCGCAATCTCGCAGACCTCATCCCGCTCAATTCGGTCTGGTCC
GGAAGCGCGGTCGCACCGTGCCCGTTTTATCCGCCAGCCTCACCGCCACTGATGCAGGTGGCGTCGGGTT
CGACCCCGTTCCGCCTCAACCTGCATGTCGACGATGTCGGTCACACTCTGATTTTCGGTCCGACCGGATC
CGGCAAATCCACCTTGTTGTCGCTGATCGCTGCGCAGTTCCGGCGTTATGCCGGTGCGCAAATCTTCGCA
TTCGACAAGGGCGGCTCGATGCTGCCTCTGACGCTCGGGCTCGATGGCGATCATTATCAGATCGGCGGAG
ATGCGACTGGGGGAGGGGAGGGGAAGGCACTTTCGTTCTGCCCGCTCGCAGACCTCACGACCGACGGCGA
CCACGCCTTCGCGGCCGAATGGATCGAGATGCTCGTTGCGCTGCAGGGTGTGACGATTACTCCCGATTAT
CGCAACGCCATCTCCCGACAGGTTGGGCTGATGGCGGAATCACGCGGGCGGTCGCTATCGGACTTCGTGT
CGGGCGTGCAGATGCGCGAGATCAAGGATGCGCTGCATCACTACACTGTCGACGGGCCGATGGGCCAGCT
TCTCGACGCCGAGGAAGACGGTCTGGCGCTGGGCAGCTTCCAGTGCTTCGAAATCGAGGAGCTCATGAAC
ATGGGCGAGCGCAATCTTGTCCCTGTCCTGACCTATCTGTTCCGTCGTATTGAAAAGCGTCTGACCGGCG
CGCCAAGCCTGATCATCCTCGACGAGGCCTGGTTGATGCTCGGCCATCCGGTCTTCCGCGACAAGATCCG
CGAATGGTTGAAGGTGTTGCGCAAGGCCAACTGCGCCGTCGTTCTTGCCACCCAATCGATCTCGGACGCC
GAACGCTCCGGCATCATCGACGTCCTGAAGGAGAGCTGCCCGACCAAAATTTGCCTGCCGAACGGGGCGG
CCCGAGAGCCGGGCACGAGAGAATTCTACGAGCGCATCGGCTTCAACGAGCGCCAGATCGAGATCGTCGC
GACCGCCATTCCGAAGCGAGACTACTACGTCGTCTCGCCGGAGGGCCGTCGTCTCTTCGACATGGCGCTC
GGACCCATCGCGCTTTCGTTCGTCGGCGCTTCCGGCAAGGAAGATCTGAAGAGCATCCGAGCTCTCCATT
CAGAACACGGGGCCTCGTGGCCTCTTCAATGGCTCCAGCAAAGGGGGATCGCCCATGCCGAAACGCTCTT
TCAAACTGAATAA
 Primer design