SecReT4
Protein ID: 222080318
T4SS name [ID]Trb [252]
Gene symboltrbD
Locus tagAvi_8332
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]256217..256516 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDB9K488
KEGG IDavi:Avi_8332
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8e-28, Aligned region: 1..92
Protein Sequence: 99 a.a.     [Download]
>gi|222080318|ref|YP_002540182.1| conjugal transfer protein [Agrobacterium vitis S4]
MADAGSNLIRSRVHRALSRPNLLMGADRELVLLTALVAVILIFVVLTWYAALFGIAIWLVAVGALRMMAK
ADPLMRRVYIRHISYKTFYRATSSPWRKF
 
Nucleotide Sequence: 300 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c256516-256217 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
GTGGCTGACGCCGGCTCCAATCTCATCCGGTCGCGGGTCCATCGGGCGCTGTCGCGTCCGAACCTGTTGA
TGGGCGCCGACCGCGAACTTGTCCTGCTGACGGCGCTTGTGGCCGTCATCCTGATCTTCGTGGTGCTGAC
CTGGTACGCCGCGCTGTTCGGGATCGCGATCTGGCTGGTCGCGGTTGGAGCCCTGCGCATGATGGCGAAA
GCCGATCCGTTAATGCGGCGGGTCTATATCAGGCACATCTCCTACAAAACCTTCTACCGCGCGACATCGT
CGCCATGGCGCAAGTTCTGA
 Primer design