SecReT4
Protein ID: 222080319
T4SS name [ID]Trb [252]
Gene symboltrbC
Locus tagAvi_8333
StrainAgrobacterium vitis S4
Repliconplasmid pTiS4 [GenBank: NC_011982] [Browse all T4SS(s) in this replicon]
Location [Strand]256509..256913 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDB9K489
KEGG IDavi:Avi_8333
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-20, Aligned region: 3..100
Protein Sequence: 134 a.a.     [Download]
>gi|222080319|ref|YP_002540183.1| conjugal transfer protein [Agrobacterium vitis S4]
MSRKTHLILTVTALALVSLGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFG
GELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGELHSQAGPFDYSPSATLIERGEGNRG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|222080117|ref|NC_011982.1|:c256913-256509 Agrobacterium vitis S4 plasmid pTiS4, complete sequence
ATGTCGCGTAAGACCCATCTTATCCTCACAGTCACAGCACTGGCCCTCGTCTCGCTCGGCTCCCTTGATG
GGGCACTGGCATCTTCCGGTGGCGGCAGCCTTCCCTGGGAATCCCCACTCCAGCAGATCCAGCAGTCGAT
TACCGGTCCCGTGGCCGGCTTCATCGCACTTGCGGCCGTCGCCATCGCCGGTGCGATGCTGATCTTCGGC
GGGGAGCTGAACGACTTTGCCCGACGGCTTTGCTACGTCGCGCTGGTCGGTGGCGTGCTTCTCGGCGCCA
CCCAGATCGTCGCCCTGTTTGGCGCGACAGGGGCGTCGATCGGCGAGCTTCATTCGCAGGCTGGCCCGTT
CGATTATTCCCCCTCCGCCACGCTCATTGAAAGAGGGGAGGGGAATCGTGGCTGA
 Primer design